Protein Family IF02687
Metagenome
Isolate
109
Members
44
Samples
107
Scaffolds
267.72
Avg Length
Representative Sequence
- ID
- 3300010049|Ga0123356_10008697|Ga0123356_100086974
- Length
- 317 aa
- Sequence
- VIILKIKIFYTNNKINVLKMPVITFKKIVLSLQIDTFCVSKCNLQTMNTNKAMNHNYIESFLHTIRASGRYSFTLEELKNEFDLPYLTIKQNLYRLKVKKKVAQIRQGFYVIIPPEYSASDILPSSLFIDSMMRYLEKPYYLGLLSAAALHGAAHQQPMVDLVVTQTPAPRNISNKKLKILFFSKKTLLDEGVVQKKTPAGYINVSSPELTAFDLLENIHSFGLNRITTVLQELYEEMLPSRLAKMAKLIDNKANIQRLGYILDRVVNEEKLASSLYKVLSINSFSPVPLSPKKGRKGEIDSKWKIIINMQIESDL*
Sample Types
Isolate
1.8%
Metagenome
98.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
46.5%
Kalotermitidae
32.6%
Unclassified
9.3%
Termopsidae
7.0%
Hodotermitidae
2.3%
Rhinotermitidae
2.3%
Taxonomy
Archaea
0
Bacteria
91
Eukaryota
0
Viruses
0
Unclassified
18
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 2 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 3 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 4 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 5 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 6 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 7 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 8 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 9 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 10 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 11 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 12 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 13 | 2820744581 | Unclassified Bacteroidetes Th196P3bin138 | Isolate | Unclassified |
| 14 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 15 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 16 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 17 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 18 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 19 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 20 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 21 | 2820781750 | Unclassified Bacteroidetes Emb289P3bin89 | Isolate | Unclassified |
| 22 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 23 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 24 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 25 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 26 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 27 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 28 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 29 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 30 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 31 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 32 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 33 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 34 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 35 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 36 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 37 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 38 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 39 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 40 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 41 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 42 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 43 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 44 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_125237 | 3300042659 | Unclassified | 1571 |
| 2 | JGI24702J35022_10062497 | 3300002462 | Unclassified | 1994 |
| 3 | Ga0072941_1019822 | 3300005201 | Bacteria | 2353 |
| 4 | Ga0466693_047630 | 3300042592 | Bacteria | 1463 |
| 5 | Ga0466694_256021 | 3300042594 | Bacteria | 3600 |
| 6 | Ga0466719_029224 | 3300042606 | Bacteria | 10040 |
| 7 | Ga0466719_326102 | 3300042606 | Bacteria | 1396 |
| 8 | Ga0466734_020292 | 3300042623 | Bacteria | 1567 |
| 9 | Ga0466704_064771 | 3300042643 | Unclassified | 2054 |
| 10 | Ga0466709_046018 | 3300042648 | Bacteria | 14812 |
| 11 | Ga0466709_051680 | 3300042648 | Bacteria | 2571 |
| 12 | Ga0466708_138595 | 3300042652 | Bacteria | 4249 |
| 13 | Ga0466727_309483 | 3300042655 | Bacteria | 2256 |
| 14 | Ga0123354_10181198 | 3300010882 | Bacteria | 2403 |
| 15 | Ga0466711_000127 | 3300042615 | Bacteria | 3700 |
| 16 | Ga0466711_457679 | 3300042615 | Bacteria | 11805 |
| 17 | Ga0466723_268807 | 3300042618 | Bacteria | 43614 |
| 18 | Ga0466691_008954 | 3300042593 | Bacteria | 17062 |
| 19 | Ga0466691_104464 | 3300042593 | Bacteria | 1602 |
| 20 | Ga0466713_012795 | 3300042602 | Bacteria | 3129 |
| 21 | Ga0466716_154947 | 3300042605 | Unclassified | 1133 |
| 22 | Ga0466698_178186 | 3300042610 | Unclassified | 1303 |
| 23 | Ga0466703_201014 | 3300042636 | Unclassified | 1874 |
| 24 | Ga0123356_10382889 | 3300010049 | Bacteria | 1540 |
| 25 | Ga0123354_10173780 | 3300010882 | Bacteria | 2493 |
| 26 | JGI24702J35022_10016326 | 3300002462 | Bacteria | 4070 |
| 27 | JGI24702J35022_10092176 | 3300002462 | Unclassified | 1650 |
| 28 | JGI24702J35022_10119823 | 3300002462 | Unclassified | 1453 |
| 29 | Ga0466656_145564 | 3300042550 | Bacteria | 3330 |
| 30 | Ga0466657_359666 | 3300042582 | Unclassified | 1260 |
| 31 | Ga0466690_138174 | 3300042590 | Bacteria | 5954 |
| 32 | Ga0466690_290746 | 3300042590 | Bacteria | 5968 |
| 33 | Ga0466694_006844 | 3300042594 | Bacteria | 1027 |
| 34 | Ga0466698_177533 | 3300042610 | Bacteria | 2622 |
| 35 | Ga0466698_200662 | 3300042610 | Bacteria | 2194 |
| 36 | Ga0466705_196917 | 3300042612 | Bacteria | 1736 |
| 37 | Ga0466731_314183 | 3300042622 | Bacteria | 2882 |
| 38 | Ga0466735_180933 | 3300042624 | Bacteria | 2024 |
| 39 | Ga0466708_084130 | 3300042652 | Bacteria | 3322 |
| 40 | Ga0123356_10597992 | 3300010049 | Bacteria | 1268 |
| 41 | Ga0123353_10049930 | 3300010167 | Bacteria | 6666 |
| 42 | Ga0466711_198189 | 3300042615 | Bacteria | 1489 |
| 43 | Ga0466715_517418 | 3300042616 | Bacteria | 17365 |
| 44 | Ga0466723_084500 | 3300042618 | Bacteria | 15044 |
| 45 | Ga0466726_046738 | 3300042619 | Bacteria | 1481 |
| 46 | Ga0466728_340392 | 3300042620 | Bacteria | 2209 |
| 47 | JGI24702J35022_10042605 | 3300002462 | Bacteria | 2417 |
| 48 | Ga0072941_1294784 | 3300005201 | Bacteria | 3939 |
| 49 | Ga0466656_189336 | 3300042550 | Unclassified | 1830 |
| 50 | Ga0466693_311660 | 3300042592 | Unclassified | 1838 |
| 51 | Ga0466696_254441 | 3300042596 | Bacteria | 3940 |
| 52 | Ga0466701_102474 | 3300042598 | Bacteria | 27466 |
| 53 | Ga0466716_275143 | 3300042605 | Bacteria | 4550 |
| 54 | Ga0466705_009614 | 3300042612 | Bacteria | 28057 |
| 55 | Ga0466703_274880 | 3300042636 | Bacteria | 36873 |
| 56 | Ga0466725_041465 | 3300042654 | Bacteria | 1742 |
| 57 | Ga0123356_10008827 | 3300010049 | Bacteria | 9985 |
| 58 | Ga0123356_10052167 | 3300010049 | Bacteria | 3804 |
| 59 | Ga0123356_10259128 | 3300010049 | Bacteria | 1822 |
| 60 | Ga0123353_10074374 | 3300010167 | Unclassified | 5462 |
| 61 | Ga0123353_10744050 | 3300010167 | Unclassified | 1366 |
| 62 | Ga0466711_051286 | 3300042615 | Bacteria | 5850 |
| 63 | Ga0466715_262889 | 3300042616 | Bacteria | 4045 |
| 64 | Ga0466715_445951 | 3300042616 | Bacteria | 1991 |
| 65 | Ga0415639_137499 | 3300038395 | Bacteria | 2113 |
| 66 | Ga0466701_017855 | 3300042598 | Bacteria | 2543 |
| 67 | Ga0466700_010606 | 3300042600 | Bacteria | 1255 |
| 68 | Ga0466707_157446 | 3300042601 | Bacteria | 2546 |
| 69 | Ga0466697_127970 | 3300042611 | Bacteria | 1570 |
| 70 | Ga0466697_280458 | 3300042611 | Bacteria | 1524 |
| 71 | Ga0466731_103400 | 3300042622 | Bacteria | 1002 |
| 72 | Ga0123354_10122863 | 3300010882 | Unclassified | 3339 |
| 73 | Ga0466715_187301 | 3300042616 | Bacteria | 2156 |
| 74 | Ga0466690_328989 | 3300042590 | Bacteria | 1352 |
| 75 | Ga0466691_026620 | 3300042593 | Bacteria | 13614 |
| 76 | Ga0466697_193506 | 3300042611 | Bacteria | 1084 |
| 77 | Ga0466708_133749 | 3300042652 | Bacteria | 10682 |
| 78 | Ga0466708_318943 | 3300042652 | Bacteria | 7822 |
| 79 | Ga0123356_10008697 | 3300010049 | Bacteria | 10069 |
| 80 | Ga0123356_10320304 | 3300010049 | Bacteria | 1663 |
| 81 | Ga0123353_10141349 | 3300010167 | Unclassified | 3855 |
| 82 | Ga0466693_167946 | 3300042592 | Bacteria | 2190 |
| 83 | Ga0466717_282352 | 3300042604 | Bacteria | 2662 |
| 84 | Ga0466716_197800 | 3300042605 | Unclassified | 2753 |
| 85 | Ga0466735_031848 | 3300042624 | Bacteria | 3054 |
| 86 | Ga0466703_233720 | 3300042636 | Unclassified | 2709 |
| 87 | Ga0466703_347654 | 3300042636 | Bacteria | 6754 |
| 88 | Ga0466725_339895 | 3300042654 | Bacteria | 2120 |
| 89 | Ga0123357_10057978 | 3300009784 | Bacteria | 5202 |
| 90 | Ga0123354_10204705 | 3300010882 | Bacteria | 2155 |
| 91 | Ga0466710_161554 | 3300042613 | Bacteria | 2181 |
| 92 | Ga0466711_101654 | 3300042615 | Bacteria | 2000 |
| 93 | Ga0466723_117184 | 3300042618 | Bacteria | 2162 |
| 94 | Ga0466733_013248 | 3300042659 | Bacteria | 4966 |
| 95 | Ga0466733_179460 | 3300042659 | Bacteria | 7578 |
| 96 | Ga0466691_077867 | 3300042593 | Bacteria | 12376 |
| 97 | Ga0466706_085763 | 3300042599 | Bacteria | 2345 |
| 98 | Ga0466707_223432 | 3300042601 | Bacteria | 5997 |
| 99 | Ga0466716_162121 | 3300042605 | Bacteria | 9060 |
| 100 | Ga0466719_027516 | 3300042606 | Bacteria | 4145 |
| 101 | Ga0466722_202823 | 3300042609 | Bacteria | 1938 |
| 102 | Ga0466722_257286 | 3300042609 | Bacteria | 1383 |
| 103 | Ga0466698_156053 | 3300042610 | Bacteria | 2719 |
| 104 | Ga0466735_021974 | 3300042624 | Bacteria | 2849 |
| 105 | Ga0466703_026600 | 3300042636 | Bacteria | 12360 |
| 106 | Ga0466704_166586 | 3300042643 | Bacteria | 1512 |
| 107 | Ga0466704_194119 | 3300042643 | Unclassified | 10522 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042612 | Ga0466705_196917 | Ga0466705_196917_1062_1715 | 217 |
| 2 | 3300042616 | Ga0466715_517418 | Ga0466715_517418_16669_17328 | 219 |
| 3 | 3300042606 | Ga0466719_326102 | Ga0466719_326102_417_1127 | 236 |
| 4 | 3300042652 | Ga0466708_318943 | Ga0466708_318943_1641_2402 | 253 |
| 5 | 3300042596 | Ga0466696_254441 | Ga0466696_254441_2748_3512 | 254 |
| 6 | 3300042592 | Ga0466693_047630 | Ga0466693_047630_368_1180 | 255 |
| 7 | 3300010167 | Ga0123353_10074374 | Ga0123353_100743744 | 256 |
| 8 | 3300042593 | Ga0466691_026620 | Ga0466691_026620_12499_13272 | 257 |
| 9 | 3300042611 | Ga0466697_193506 | Ga0466697_193506_183_998 | 262 |
| 10 | 3300042624 | Ga0466735_021974 | Ga0466735_021974_1187_1975 | 262 |
| 11 | 3300042594 | Ga0466694_006844 | Ga0466694_006844_169_963 | 264 |
| 12 | 3300042601 | Ga0466707_157446 | Ga0466707_157446_249_1043 | 264 |
| 13 | 3300042613 | Ga0466710_161554 | Ga0466710_161554_1034_1828 | 264 |
| 14 | 3300010167 | Ga0123353_10141349 | Ga0123353_101413492 | 265 |
| 15 | 3300042610 | Ga0466698_177533 | Ga0466698_177533_608_1405 | 265 |
| 16 | 3300042615 | Ga0466711_000127 | Ga0466711_000127_1362_2159 | 265 |
| 17 | 3300042636 | Ga0466703_026600 | Ga0466703_026600_8441_9238 | 265 |
| 18 | 3300042652 | Ga0466708_084130 | Ga0466708_084130_1591_2388 | 265 |
| 19 | 3300005201 | Ga0072941_1019822 | Ga0072941_10198222 | 266 |
| 20 | 3300042609 | Ga0466722_257286 | Ga0466722_257286_408_1208 | 266 |
| 21 | 3300042612 | Ga0466705_009614 | Ga0466705_009614_19986_20786 | 266 |
| 22 | 3300042616 | Ga0466715_262889 | Ga0466715_262889_988_1788 | 266 |
| 23 | 3300042623 | Ga0466734_020292 | Ga0466734_020292_447_1247 | 266 |
| 24 | 3300042624 | Ga0466735_031848 | Ga0466735_031848_1192_1992 | 266 |
| 25 | 3300042636 | Ga0466703_201014 | Ga0466703_201014_1017_1817 | 266 |
| 26 | 3300042652 | Ga0466708_138595 | Ga0466708_138595_662_1462 | 266 |
| 27 | 3300042655 | Ga0466727_309483 | Ga0466727_309483_1009_1809 | 266 |
| 28 | 3300010049 | Ga0123356_10052167 | Ga0123356_100521673 | 267 |
| 29 | 3300042610 | Ga0466698_156053 | Ga0466698_156053_415_1218 | 267 |
| 30 | 3300042610 | Ga0466698_178186 | Ga0466698_178186_258_1061 | 267 |
| 31 | 3300042659 | Ga0466733_013248 | Ga0466733_013248_1198_2001 | 267 |
| 32 | 3300042659 | Ga0466733_125237 | Ga0466733_125237_482_1285 | 267 |
| 33 | 3300042659 | Ga0466733_179460 | Ga0466733_179460_3881_4684 | 267 |
| 34 | 3300038395 | Ga0415639_137499 | Ga0415639_137499_708_1514 | 268 |
| 35 | 3300042550 | Ga0466656_145564 | Ga0466656_145564_1779_2585 | 268 |
| 36 | 3300042550 | Ga0466656_189336 | Ga0466656_189336_178_984 | 268 |
| 37 | 3300042590 | Ga0466690_138174 | Ga0466690_138174_88_894 | 268 |
| 38 | 3300042590 | Ga0466690_290746 | Ga0466690_290746_2882_3688 | 268 |
| 39 | 3300042590 | Ga0466690_328989 | Ga0466690_328989_365_1171 | 268 |
| 40 | 3300042592 | Ga0466693_311660 | Ga0466693_311660_771_1577 | 268 |
| 41 | 3300042593 | Ga0466691_077867 | Ga0466691_077867_6978_7784 | 268 |
| 42 | 3300042593 | Ga0466691_104464 | Ga0466691_104464_619_1425 | 268 |
| 43 | 3300042598 | Ga0466701_017855 | Ga0466701_017855_581_1387 | 268 |
| 44 | 3300042598 | Ga0466701_102474 | Ga0466701_102474_20119_20925 | 268 |
| 45 | 3300042599 | Ga0466706_085763 | Ga0466706_085763_1285_2091 | 268 |
| 46 | 3300042600 | Ga0466700_010606 | Ga0466700_010606_161_967 | 268 |
| 47 | 3300042602 | Ga0466713_012795 | Ga0466713_012795_1296_2102 | 268 |
| 48 | 3300042605 | Ga0466716_154947 | Ga0466716_154947_11_817 | 268 |
| 49 | 3300042605 | Ga0466716_162121 | Ga0466716_162121_717_1523 | 268 |
| 50 | 3300042605 | Ga0466716_197800 | Ga0466716_197800_344_1150 | 268 |
| 51 | 3300042605 | Ga0466716_275143 | Ga0466716_275143_243_1049 | 268 |
| 52 | 3300042606 | Ga0466719_027516 | Ga0466719_027516_2899_3705 | 268 |
| 53 | 3300042606 | Ga0466719_029224 | Ga0466719_029224_1345_2151 | 268 |
| 54 | 3300042609 | Ga0466722_202823 | Ga0466722_202823_448_1254 | 268 |
| 55 | 3300042610 | Ga0466698_200662 | Ga0466698_200662_344_1150 | 268 |
| 56 | 3300042611 | Ga0466697_127970 | Ga0466697_127970_388_1194 | 268 |
| 57 | 3300042611 | Ga0466697_280458 | Ga0466697_280458_573_1379 | 268 |
| 58 | 3300042615 | Ga0466711_051286 | Ga0466711_051286_4473_5279 | 268 |
| 59 | 3300042615 | Ga0466711_101654 | Ga0466711_101654_478_1284 | 268 |
| 60 | 3300042615 | Ga0466711_198189 | Ga0466711_198189_573_1379 | 268 |
| 61 | 3300042615 | Ga0466711_457679 | Ga0466711_457679_8479_9285 | 268 |
| 62 | 3300042616 | Ga0466715_445951 | Ga0466715_445951_1153_1959 | 268 |
| 63 | 3300042618 | Ga0466723_084500 | Ga0466723_084500_1286_2092 | 268 |
| 64 | 3300042618 | Ga0466723_117184 | Ga0466723_117184_279_1085 | 268 |
| 65 | 3300042618 | Ga0466723_268807 | Ga0466723_268807_12646_13452 | 268 |
| 66 | 3300042619 | Ga0466726_046738 | Ga0466726_046738_107_913 | 268 |
| 67 | 3300042620 | Ga0466728_340392 | Ga0466728_340392_401_1207 | 268 |
| 68 | 3300042622 | Ga0466731_314183 | Ga0466731_314183_387_1193 | 268 |
| 69 | 3300042636 | Ga0466703_233720 | Ga0466703_233720_1053_1859 | 268 |
| 70 | 3300042636 | Ga0466703_347654 | Ga0466703_347654_4946_5752 | 268 |
| 71 | 3300042643 | Ga0466704_064771 | Ga0466704_064771_208_1014 | 268 |
| 72 | 3300042643 | Ga0466704_166586 | Ga0466704_166586_236_1042 | 268 |
| 73 | 3300042643 | Ga0466704_194119 | Ga0466704_194119_5741_6547 | 268 |
| 74 | 3300042648 | Ga0466709_046018 | Ga0466709_046018_5088_5894 | 268 |
| 75 | 3300042648 | Ga0466709_051680 | Ga0466709_051680_1185_1991 | 268 |
| 76 | 3300042652 | Ga0466708_133749 | Ga0466708_133749_3166_3972 | 268 |
| 77 | 3300042654 | Ga0466725_041465 | Ga0466725_041465_872_1678 | 268 |
| 78 | 3300042654 | Ga0466725_339895 | Ga0466725_339895_722_1528 | 268 |
| 79 | iso_pr_bacteria | 2820744581 | 2820745587 | 268 |
| 80 | 3300002462 | JGI24702J35022_10016326 | JGI24702J35022_100163267 | 269 |
| 81 | 3300002462 | JGI24702J35022_10062497 | JGI24702J35022_100624972 | 269 |
| 82 | 3300002462 | JGI24702J35022_10092176 | JGI24702J35022_100921762 | 269 |
| 83 | 3300002462 | JGI24702J35022_10119823 | JGI24702J35022_101198231 | 269 |
| 84 | 3300005201 | Ga0072941_1294784 | Ga0072941_12947844 | 269 |
| 85 | 3300010049 | Ga0123356_10259128 | Ga0123356_102591283 | 269 |
| 86 | 3300010049 | Ga0123356_10320304 | Ga0123356_103203042 | 269 |
| 87 | 3300010049 | Ga0123356_10382889 | Ga0123356_103828891 | 269 |
| 88 | 3300010049 | Ga0123356_10597992 | Ga0123356_105979922 | 269 |
| 89 | 3300010167 | Ga0123353_10049930 | Ga0123353_100499303 | 269 |
| 90 | 3300010882 | Ga0123354_10122863 | Ga0123354_101228632 | 269 |
| 91 | 3300042592 | Ga0466693_167946 | Ga0466693_167946_987_1796 | 269 |
| 92 | 3300042601 | Ga0466707_223432 | Ga0466707_223432_4210_5019 | 269 |
| 93 | 3300042604 | Ga0466717_282352 | Ga0466717_282352_854_1663 | 269 |
| 94 | 3300002462 | JGI24702J35022_10042605 | JGI24702J35022_100426052 | 270 |
| 95 | 3300042582 | Ga0466657_359666 | Ga0466657_359666_117_929 | 270 |
| 96 | 3300042622 | Ga0466731_103400 | Ga0466731_103400_122_934 | 270 |
| 97 | 3300042624 | Ga0466735_180933 | Ga0466735_180933_640_1452 | 270 |
| 98 | iso_pr_bacteria | 2820781750 | 2820782508 | 270 |
| 99 | 3300010049 | Ga0123356_10008827 | Ga0123356_100088277 | 271 |
| 100 | 3300010167 | Ga0123353_10744050 | Ga0123353_107440502 | 271 |
| 101 | 3300010882 | Ga0123354_10173780 | Ga0123354_101737802 | 271 |
| 102 | 3300010882 | Ga0123354_10181198 | Ga0123354_101811982 | 271 |
| 103 | 3300010882 | Ga0123354_10204705 | Ga0123354_102047052 | 271 |
| 104 | 3300042593 | Ga0466691_008954 | Ga0466691_008954_5783_6601 | 272 |
| 105 | 3300042636 | Ga0466703_274880 | Ga0466703_274880_5183_6010 | 275 |
| 106 | 3300042594 | Ga0466694_256021 | Ga0466694_256021_2192_3112 | 306 |
| 107 | 3300042616 | Ga0466715_187301 | Ga0466715_187301_1009_1953 | 314 |
| 108 | 3300009784 | Ga0123357_10057978 | Ga0123357_100579783 | 315 |
| 109 | 3300010049 | Ga0123356_10008697 | Ga0123356_100086974 | 317 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF09407 | AbiEi_1 | AbiEi antitoxin C-terminal domain | 123 | 264 | 0.92 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.78 | 0.86 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.