Protein Family IF02652
Metagenome
Isolate
245
Members
102
Samples
191
Scaffolds
377.42
Avg Length
Representative Sequence
- ID
- 3300010049|Ga0123356_10002404|Ga0123356_1000240411
- Length
- 436 aa
- Sequence
- MANRSVFSQERKICGEGRILNSGSIRKPLNGVTKKQTWPAARRLKEVNILDFLQMLYDFSQLIFGNMVATTWQQLVMWLIGGVLIYLAVKKDMEPTLLLPIGFGAILANLPFSGAITQTINGITEPGILDVLFNAGIANEALPLLLFIGIGAMIDFGPLLSNPKLLLFGAAAQFGIFFTLSMAALIGFDIRDAASIAIIGAADGPTSIFVANFFHSHYLGAIIVAAYSYMALVPIVQPPVIRLLTTKKERLIRMPYNPQNVPQIVKILFPIIVXXXXGXVAPVSVALVGFLMFGNLVRECGVLNQLSKGAQNELANIVTLLLGLTIAVRMQAEDFLRFATLMIISLGLVAFVFDTVGGVLFAKILNLFVKNKFNPMIGACGISAFPMSARVIHKMARKEDDQNFLLMHTVGVNVGGQVASVIAGGLVIALVSRLL*
Sample Types
Isolate
22.0%
Metagenome
78.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
21.5%
Unclassified
18.3%
Kalotermitidae
15.1%
Blattidae
12.9%
Tenebrionidae
7.5%
Drosophilidae
3.2%
Rhinotermitidae
3.2%
Passalidae
3.2%
Stratiomyidae
2.2%
Termopsidae
2.2%
Scarabaeidae
2.2%
Formicidae
2.2%
Libellulidae
1.1%
Bombycidae
1.1%
Hodotermitidae
1.1%
Dytiscidae
1.1%
Hydrophilidae
1.1%
Gomphidae
1.1%
Taxonomy
Archaea
0
Bacteria
221
Eukaryota
0
Viruses
0
Unclassified
24
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 8114541043 | Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 | Isolate | Libellulidae |
| 2 | 2902668162 | Lacticaseibacillus paracasei DmW_181 | Isolate | Drosophilidae |
| 3 | 2940286528 | Lachnospiraceae bacterium PFB1-21 | Isolate | Blattidae |
| 4 | 8030343600 | Proteiniborus sp. MB09-C3 | Isolate | Stratiomyidae |
| 5 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 6 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 7 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 8 | 8114555646 | Enterococcus sp. DIV1094 | Isolate | |
| 9 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 10 | 2503904012 | Sphaerochaeta coccoides SPN1, DSM 17374 | Isolate | Kalotermitidae |
| 11 | 2775507073 | Enterococcus sp. CR-Ec1 | Isolate | Unclassified |
| 12 | 2781125642 | Treponema sp. Co191P1bin35 | Isolate | Unclassified |
| 13 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 14 | 8012939035 | Enterococcus sp. UD-01 | Isolate | Tenebrionidae |
| 15 | 2940218408 | Enterococcus sp. PF1-24 | Isolate | Blattidae |
| 16 | 2940280053 | Lachnospiraceae bacterium PF1-22 | Isolate | Blattidae |
| 17 | 2944625312 | Dysgonomonas sp. PF1-3 | Isolate | Blattidae |
| 18 | 2585428085 | Sporobacter termitidis DSM 10068 | Isolate | Termitidae |
| 19 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 20 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 21 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 22 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 23 | 8030337018 | Tissierella sp. Yu-01 | Isolate | Stratiomyidae |
| 24 | 8038268975 | Enterococcus mundtii EM01 | Isolate | Bombycidae |
| 25 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 26 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 27 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 28 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 29 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 30 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 31 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 32 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 33 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 34 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 35 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 36 | 2873593402 | Erysipelothrix sp. HDW6A | Isolate | Dytiscidae |
| 37 | 2873597894 | Erysipelothrix sp. HDW6B | Isolate | Unclassified |
| 38 | 2940261461 | Enterococcus sp. PFB1-1 | Isolate | Blattidae |
| 39 | 2940289514 | Lachnospiraceae bacterium PM6-15 | Isolate | Blattidae |
| 40 | 2622736579 | Desemzia incerta DSM 20581 | Isolate | Unclassified |
| 41 | 2740892556 | Enterococcus sp. JR029-101 | Isolate | Unclassified |
| 42 | 2820724199 | Unclassified Cloacimonetes Th196P3bin22 | Isolate | Unclassified |
| 43 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 44 | 8108568626 | Enterococcus sp. DIV1094 | Isolate | |
| 45 | 8108576847 | Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 | Isolate | |
| 46 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 47 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 48 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 49 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 50 | 8114537524 | Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 | Isolate | |
| 51 | 2825804107 | Enterococcus durans BDGP3 | Isolate | Drosophilidae |
| 52 | 2940292506 | Lachnoclostridium sp. PH5-23 | Isolate | Blattidae |
| 53 | 2781125638 | Treponema sp. Co191P1bin8 | Isolate | Unclassified |
| 54 | 2820367663 | Unclassified Firmicutes Nt197P3bin105 | Isolate | Unclassified |
| 55 | 2820389254 | Unclassified Firmicutes Nc150P4bin19 | Isolate | Unclassified |
| 56 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 57 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 58 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 59 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 60 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 61 | 8007237282 | Enterococcus sp. DIV0212c | Isolate | |
| 62 | 8018794549 | Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 | Isolate | |
| 63 | 8018798118 | Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 | Isolate | |
| 64 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 65 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 66 | 8114549044 | Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 | Isolate | |
| 67 | 2873595552 | Erysipelothrix sp. HDW6C | Isolate | Hydrophilidae |
| 68 | 2940277027 | Lachnospiraceae bacterium PF1-21 | Isolate | Blattidae |
| 69 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 70 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 71 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 72 | 647533136 | Enterococcus faecalis Fly1 | Isolate | Drosophilidae |
| 73 | 8007220153 | Enterococcus sp. BWB1-3 | Isolate | Scarabaeidae |
| 74 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 75 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 76 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 77 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 78 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 79 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 80 | 2940230426 | Lachnospiraceae bacterium PH5-48 | Isolate | Blattidae |
| 81 | 2940283334 | Lachnospiraceae bacterium PF1-4 | Isolate | Blattidae |
| 82 | 2940295490 | Lachnospiraceae bacterium PH1-22 | Isolate | Blattidae |
| 83 | 2781125651 | Treponema sp. Co191P3bin8 | Isolate | Unclassified |
| 84 | 2820727601 | Unclassified Cloacimonetes Nt197P3bin46 | Isolate | Unclassified |
| 85 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 86 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 87 | 651324002 | Acetonema longum APO-1, DSM 6540 | Isolate | Kalotermitidae |
| 88 | 8018802046 | Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 | Isolate | Gomphidae |
| 89 | 2997944163 | Streptococcus penaeicida CAIM 1838 | Isolate | Unclassified |
| 90 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 91 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 92 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 93 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 94 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 95 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 96 | 2940233634 | Lachnoclostridium sp. PF5-10 | Isolate | Blattidae |
| 97 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 98 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 99 | 8002299145 | Vagococcus allomyrinae BWB3-3 | Isolate | Scarabaeidae |
| 100 | 8077780672 | Enterococcus sp. PLM3 | Isolate | Formicidae |
| 101 | 2989309576 | Sporomusa termitida DSM 4440 | Isolate | Unclassified |
| 102 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_200485 | 3300042612 | Unclassified | 1799 |
| 2 | Ga0562379_0092 | 3300056790 | Bacteria | 317609 |
| 3 | Ga0562376_1491 | 3300056857 | Bacteria | 32420 |
| 4 | Ga0123353_10192061 | 3300010167 | Bacteria | 3222 |
| 5 | Ga0123353_10281440 | 3300010167 | Bacteria | 2554 |
| 6 | Ga0123354_10099953 | 3300010882 | Bacteria | 3931 |
| 7 | Ga0466703_112682 | 3300042636 | Bacteria | 2845 |
| 8 | Ga0466704_140761 | 3300042643 | Bacteria | 2269 |
| 9 | Ga0466708_160938 | 3300042652 | Bacteria | 18767 |
| 10 | Ga0466708_263298 | 3300042652 | Bacteria | 3342 |
| 11 | Ga0466701_026006 | 3300042598 | Unclassified | 6841 |
| 12 | Ga0466706_073876 | 3300042599 | Unclassified | 2227 |
| 13 | Ga0466706_187731 | 3300042599 | Unclassified | 2163 |
| 14 | Ga0466707_082474 | 3300042601 | Bacteria | 105318 |
| 15 | Ga0466707_251332 | 3300042601 | Bacteria | 2550 |
| 16 | Ga0466713_031365 | 3300042602 | Bacteria | 59157 |
| 17 | Ga0466713_153447 | 3300042602 | Bacteria | 13421 |
| 18 | Ga0466690_228009 | 3300042590 | Bacteria | 19764 |
| 19 | Ga0466696_230481 | 3300042596 | Bacteria | 1898 |
| 20 | 2227216900 | 2225789004 | Bacteria | 7544 |
| 21 | IMNBL1DRAFT_c0000279 | 3300000062 | Bacteria | 45201 |
| 22 | IMNBL1DRAFT_c0003141 | 3300000062 | Bacteria | 10863 |
| 23 | IMNBL1DRAFT_c0018989 | 3300000062 | Bacteria | 2834 |
| 24 | Ga0466728_031879 | 3300042620 | Bacteria | 15219 |
| 25 | Ga0466729_112245 | 3300042621 | Bacteria | 1461 |
| 26 | Ga0466697_192316 | 3300042611 | Bacteria | 2090 |
| 27 | Ga0562378_0194 | 3300056814 | Unclassified | 147808 |
| 28 | Ga0123353_10152499 | 3300010167 | Bacteria | 3687 |
| 29 | Ga0123353_10387770 | 3300010167 | Bacteria | 2086 |
| 30 | Ga0466729_200622 | 3300042621 | Bacteria | 6737 |
| 31 | Ga0466702_064902 | 3300042635 | Bacteria | 1491 |
| 32 | Ga0466703_416198 | 3300042636 | Bacteria | 1688 |
| 33 | Ga0466704_066201 | 3300042643 | Bacteria | 6856 |
| 34 | Ga0466727_085753 | 3300042655 | Bacteria | 33439 |
| 35 | Ga0466706_082465 | 3300042599 | Bacteria | 9059 |
| 36 | Ga0466706_238760 | 3300042599 | Bacteria | 1259 |
| 37 | Ga0466700_095378 | 3300042600 | Bacteria | 87403 |
| 38 | Ga0466722_107639 | 3300042609 | Bacteria | 2691 |
| 39 | 2227117225 | 2225789004 | Bacteria | 1717 |
| 40 | IMNBL1DRAFT_c0001261 | 3300000062 | Bacteria | 19129 |
| 41 | IMNBL1DRAFT_c0001395 | 3300000062 | Bacteria | 18166 |
| 42 | IMNBL1DRAFT_c0003046 | 3300000062 | Bacteria | 11065 |
| 43 | Ga0466726_262297 | 3300042619 | Bacteria | 2845 |
| 44 | Ga0466728_289962 | 3300042620 | Bacteria | 4108 |
| 45 | Ga0123353_10198247 | 3300010167 | Bacteria | 3162 |
| 46 | Ga0466704_069001 | 3300042643 | Bacteria | 4319 |
| 47 | Ga0466708_062403 | 3300042652 | Bacteria | 26662 |
| 48 | Ga0466706_082743 | 3300042599 | Bacteria | 4155 |
| 49 | Ga0466713_023787 | 3300042602 | Bacteria | 11137 |
| 50 | Ga0466722_259936 | 3300042609 | Bacteria | 16013 |
| 51 | 2227499619 | 2225789004 | Bacteria | 19624 |
| 52 | IMNBL1DRAFT_c0000494 | 3300000062 | Bacteria | 32923 |
| 53 | IMNBL1DRAFT_c0001728 | 3300000062 | Bacteria | 16028 |
| 54 | JGI24695J34938_10001767 | 3300002450 | Bacteria | 17840 |
| 55 | JGI24695J34938_10008306 | 3300002450 | Bacteria | 5937 |
| 56 | Ga0072941_1021705 | 3300005201 | Bacteria | 24146 |
| 57 | Ga0072941_1070834 | 3300005201 | Bacteria | 3604 |
| 58 | Ga0466715_187894 | 3300042616 | Bacteria | 3133 |
| 59 | Ga0466726_265603 | 3300042619 | Bacteria | 6692 |
| 60 | Ga0466733_174911 | 3300042659 | Bacteria | 11754 |
| 61 | Ga0562375_0018 | 3300056856 | Bacteria | 940838 |
| 62 | Ga0562375_0036 | 3300056856 | Bacteria | 609533 |
| 63 | Ga0562375_0046 | 3300056856 | Unclassified | 491016 |
| 64 | Ga0123353_10200622 | 3300010167 | Bacteria | 3139 |
| 65 | Ga0123353_10694521 | 3300010167 | Bacteria | 1430 |
| 66 | Ga0466702_026387 | 3300042635 | Bacteria | 4629 |
| 67 | Ga0466704_555679 | 3300042643 | Bacteria | 35835 |
| 68 | Ga0466724_62505 | 3300042649 | Bacteria | 2205 |
| 69 | Ga0466708_364886 | 3300042652 | Bacteria | 16612 |
| 70 | Ga0466706_148168 | 3300042599 | Bacteria | 1966 |
| 71 | Ga0466707_199301 | 3300042601 | Unclassified | 3077 |
| 72 | Ga0466719_207422 | 3300042606 | Bacteria | 16146 |
| 73 | Ga0466699_306516 | 3300042597 | Bacteria | 2588 |
| 74 | Ga0466699_434484 | 3300042597 | Bacteria | 8253 |
| 75 | 2227441900 | 2225789004 | Unclassified | 25945 |
| 76 | 2227513830 | 2225789004 | Bacteria | 3493 |
| 77 | IMNBL1DRAFT_c0011238 | 3300000062 | Bacteria | 4200 |
| 78 | JGI24695J34938_10000171 | 3300002450 | Bacteria | 60520 |
| 79 | Ga0466715_425272 | 3300042616 | Bacteria | 1972 |
| 80 | Ga0562378_0319 | 3300056814 | Unclassified | 98233 |
| 81 | Ga0562377_0019 | 3300056842 | Bacteria | 1067000 |
| 82 | Ga0562377_1124 | 3300056842 | Unclassified | 31714 |
| 83 | Ga0562375_0246 | 3300056856 | Bacteria | 147023 |
| 84 | Ga0123356_10002404 | 3300010049 | Bacteria | 20028 |
| 85 | Ga0123356_10116479 | 3300010049 | Bacteria | 2591 |
| 86 | Ga0466709_388758 | 3300042648 | Bacteria | 19307 |
| 87 | Ga0466727_324265 | 3300042655 | Bacteria | 57686 |
| 88 | Ga0466706_114772 | 3300042599 | Bacteria | 128005 |
| 89 | Ga0466707_158334 | 3300042601 | Unclassified | 4514 |
| 90 | Ga0466719_039820 | 3300042606 | Bacteria | 14410 |
| 91 | Ga0466719_300269 | 3300042606 | Unclassified | 1637 |
| 92 | Ga0466657_084129 | 3300042582 | Bacteria | 1168 |
| 93 | Ga0466693_193542 | 3300042592 | Bacteria | 34341 |
| 94 | 2227164124 | 2225789004 | Bacteria | 35807 |
| 95 | 2227594658 | 2225789004 | Unclassified | 2390 |
| 96 | Ga0466715_039313 | 3300042616 | Unclassified | 1452 |
| 97 | Ga0466715_069337 | 3300042616 | Bacteria | 68642 |
| 98 | Ga0466715_410276 | 3300042616 | Bacteria | 7544 |
| 99 | Ga0466715_421137 | 3300042616 | Bacteria | 6577 |
| 100 | Ga0466715_544192 | 3300042616 | Bacteria | 15210 |
| 101 | Ga0466729_065657 | 3300042621 | Bacteria | 2514 |
| 102 | Ga0466705_022437 | 3300042612 | Bacteria | 24966 |
| 103 | Ga0466705_036513 | 3300042612 | Bacteria | 122886 |
| 104 | Ga0466705_105365 | 3300042612 | Bacteria | 1660 |
| 105 | Ga0123356_10545664 | 3300010049 | Bacteria | 1320 |
| 106 | Ga0123353_10022447 | 3300010167 | Bacteria | 9518 |
| 107 | Ga0123353_10041013 | 3300010167 | Bacteria | 7307 |
| 108 | Ga0123353_10049068 | 3300010167 | Bacteria | 6724 |
| 109 | Ga0466729_253864 | 3300042621 | Bacteria | 15671 |
| 110 | Ga0466702_057005 | 3300042635 | Bacteria | 3047 |
| 111 | Ga0466703_052208 | 3300042636 | Unclassified | 13397 |
| 112 | Ga0466703_234264 | 3300042636 | Bacteria | 12348 |
| 113 | Ga0466709_115669 | 3300042648 | Bacteria | 217304 |
| 114 | Ga0466706_011267 | 3300042599 | Bacteria | 3093 |
| 115 | Ga0466706_082350 | 3300042599 | Bacteria | 2657 |
| 116 | Ga0466706_096162 | 3300042599 | Bacteria | 37393 |
| 117 | Ga0466706_279758 | 3300042599 | Bacteria | 21465 |
| 118 | Ga0466700_157938 | 3300042600 | Bacteria | 2159 |
| 119 | Ga0466707_277438 | 3300042601 | Unclassified | 2711 |
| 120 | Ga0466720_225102 | 3300042607 | Bacteria | 2058 |
| 121 | Ga0466690_087910 | 3300042590 | Bacteria | 67683 |
| 122 | 2227065804 | 2225789003 | Unclassified | 3341 |
| 123 | 2227521857 | 2225789004 | Bacteria | 17099 |
| 124 | IMNBL1DRAFT_c0003559 | 3300000062 | Bacteria | 9905 |
| 125 | JGI24695J34938_10000156 | 3300002450 | Bacteria | 63017 |
| 126 | JGI24695J34938_10008981 | 3300002450 | Bacteria | 5623 |
| 127 | Ga0466705_390387 | 3300042612 | Bacteria | 4311 |
| 128 | Ga0466705_498231 | 3300042612 | Bacteria | 1956 |
| 129 | Ga0466715_036720 | 3300042616 | Bacteria | 9199 |
| 130 | Ga0466715_066943 | 3300042616 | Bacteria | 3854 |
| 131 | Ga0466723_338813 | 3300042618 | Bacteria | 15460 |
| 132 | Ga0466726_350669 | 3300042619 | Bacteria | 2020 |
| 133 | Ga0466728_080658 | 3300042620 | Bacteria | 3058 |
| 134 | Ga0466705_112590 | 3300042612 | Bacteria | 9990 |
| 135 | Ga0562374_0062 | 3300057007 | Bacteria | 360944 |
| 136 | Ga0123356_10251778 | 3300010049 | Bacteria | 1844 |
| 137 | Ga0123353_10179603 | 3300010167 | Bacteria | 3352 |
| 138 | Ga0466702_044671 | 3300042635 | Bacteria | 109377 |
| 139 | Ga0466706_226886 | 3300042599 | Bacteria | 4192 |
| 140 | Ga0466706_239732 | 3300042599 | Bacteria | 1282 |
| 141 | Ga0466698_107959 | 3300042610 | Bacteria | 6168 |
| 142 | Ga0466692_006717 | 3300042591 | Bacteria | 4471 |
| 143 | Ga0466691_028626 | 3300042593 | Bacteria | 9449 |
| 144 | Ga0466699_173997 | 3300042597 | Unclassified | 2035 |
| 145 | 2227535733 | 2225789004 | Bacteria | 56982 |
| 146 | 2227560733 | 2225789004 | Bacteria | 14486 |
| 147 | IMNBL1DRAFT_c0000088 | 3300000062 | Bacteria | 80215 |
| 148 | IMNBL1DRAFT_c0005340 | 3300000062 | Bacteria | 7380 |
| 149 | IMNBL1DRAFT_c0005865 | 3300000062 | Bacteria | 6881 |
| 150 | JGI24695J34938_10017744 | 3300002450 | Bacteria | 3575 |
| 151 | Ga0466710_331981 | 3300042613 | Unclassified | 2836 |
| 152 | Ga0466715_089002 | 3300042616 | Bacteria | 1858 |
| 153 | Ga0466715_443438 | 3300042616 | Bacteria | 4292 |
| 154 | Ga0466705_303992 | 3300042612 | Bacteria | 4504 |
| 155 | Ga0466733_167157 | 3300042659 | Bacteria | 20372 |
| 156 | Ga0562379_0698 | 3300056790 | Unclassified | 56893 |
| 157 | Ga0562377_0028 | 3300056842 | Bacteria | 766538 |
| 158 | Ga0562376_0072 | 3300056857 | Bacteria | 246902 |
| 159 | Ga0562376_1362 | 3300056857 | Unclassified | 34810 |
| 160 | Ga0123353_10167968 | 3300010167 | Bacteria | 3485 |
| 161 | Ga0123353_10534880 | 3300010167 | Bacteria | 1695 |
| 162 | Ga0466703_216974 | 3300042636 | Bacteria | 2045 |
| 163 | Ga0466704_613443 | 3300042643 | Bacteria | 4977 |
| 164 | Ga0466709_039865 | 3300042648 | Bacteria | 21232 |
| 165 | Ga0466708_227476 | 3300042652 | Bacteria | 3523 |
| 166 | Ga0466706_077725 | 3300042599 | Bacteria | 5481 |
| 167 | Ga0466706_178990 | 3300042599 | Bacteria | 2500 |
| 168 | Ga0466700_136144 | 3300042600 | Bacteria | 1527 |
| 169 | Ga0466707_247224 | 3300042601 | Unclassified | 143661 |
| 170 | Ga0466707_322802 | 3300042601 | Bacteria | 14394 |
| 171 | Ga0466707_327485 | 3300042601 | Unclassified | 14923 |
| 172 | Ga0466714_084203 | 3300042603 | Bacteria | 3838 |
| 173 | Ga0466719_014220 | 3300042606 | Bacteria | 7815 |
| 174 | Ga0466719_210722 | 3300042606 | Bacteria | 2736 |
| 175 | Ga0466693_176126 | 3300042592 | Bacteria | 4923 |
| 176 | Ga0466694_218773 | 3300042594 | Unclassified | 1696 |
| 177 | Ga0466696_215628 | 3300042596 | Bacteria | 88162 |
| 178 | JGI24695J34938_10000019 | 3300002450 | Bacteria | 113818 |
| 179 | JGI24695J34938_10000062 | 3300002450 | Bacteria | 88353 |
| 180 | JGI24695J34938_10000627 | 3300002450 | Bacteria | 33643 |
| 181 | JGI24695J34938_10001218 | 3300002450 | Bacteria | 22750 |
| 182 | JGI24695J34938_10014115 | 3300002450 | Bacteria | 4159 |
| 183 | JGI24695J34938_10041197 | 3300002450 | Bacteria | 2074 |
| 184 | JGI24702J35022_10005550 | 3300002462 | Bacteria | 7358 |
| 185 | CVPL010L_1000134 | 3300002932 | Bacteria | 35879 |
| 186 | Ga0466715_081391 | 3300042616 | Bacteria | 24207 |
| 187 | Ga0466715_113254 | 3300042616 | Bacteria | 52859 |
| 188 | Ga0466715_139954 | 3300042616 | Bacteria | 28732 |
| 189 | Ga0466715_631927 | 3300042616 | Bacteria | 2882 |
| 190 | Ga0466723_002342 | 3300042618 | Bacteria | 16756 |
| 191 | Ga0466723_172507 | 3300042618 | Bacteria | 3184 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF03977 | OAD_beta | Na+-transporting oxaloacetate decarboxylase beta subunit | 73 | 430 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.