Protein Family IF02643

Metagenome Isolate
140 Members
47 Samples
112 Scaffolds
176.23 Avg Length

🧬 Representative Sequence

ID
3300010049|Ga0123356_10001598|Ga0123356_100015986
Length
191 aa
Sequence
MQTNAQALSNTHALTLADAIDIGFIDVKQAEFFQTAGGFIGLRYGGKEYPRVSFRRALPVGQPSAYISVADGENKEIGILRDVAALADDQLKIVTAELDRRYYCPLVLEIKSVKDKLGYVYLELRIQGAGSEGQGKIYDRNCAIKDVNKNIRMLDDNRLILFDVDGNRYMVPSLSGLEKKSLKRLEPYLF*

📊 Sample Types

Isolate 20.0%
Metagenome 80.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 59.6%
Termitidae 36.2%
Passalidae 2.1%
Kalotermitidae 2.1%

🌳 Taxonomy

Archaea 0
Bacteria 130
Eukaryota 0
Viruses 0
Unclassified 10

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
2 2820285501 Unclassified Firmicutes Th196P3bin142 Isolate Unclassified
3 2820435670 Unclassified Firmicutes Lab288P3bin217 Isolate Unclassified
4 2820698910 Unclassified Firmicutes Co191P1bin64 Isolate Unclassified
5 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
6 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
7 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
8 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
9 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
10 2820444930 Unclassified Firmicutes Lab288P3bin199 Isolate Unclassified
11 2820630457 Unclassified Firmicutes Emb289P1bin119 Isolate Unclassified
12 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
13 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
14 2820472365 Unclassified Firmicutes Lab288P1bin87 Isolate Unclassified
15 2820615445 Unclassified Firmicutes Emb289P1bin132 Isolate Unclassified
16 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
17 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
18 2820623020 Unclassified Firmicutes Emb289P1bin126 Isolate Unclassified
19 2820685979 Unclassified Firmicutes Co191P1bin81 Isolate Unclassified
20 2820696217 Unclassified Firmicutes Co191P1bin66 Isolate Unclassified
21 2820329821 Unclassified Firmicutes Nt197P3bin77 Isolate Unclassified
22 2820378768 Unclassified Firmicutes Nt197P1bin7 Isolate Unclassified
23 2820382897 Unclassified Firmicutes Nt197P1bin3 Isolate Unclassified
24 2820573558 Unclassified Firmicutes Emb289P3bin140 Isolate Unclassified
25 2820617402 Unclassified Firmicutes Emb289P1bin131 Isolate Unclassified
26 2820627938 Unclassified Firmicutes Emb289P1bin122 Isolate Unclassified
27 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
28 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
29 2820380671 Unclassified Firmicutes Nt197P1bin4 Isolate Unclassified
30 2820600392 Unclassified Firmicutes Emb289P1bin52 Isolate Unclassified
31 2820607737 Unclassified Firmicutes Emb289P1bin48 Isolate Unclassified
32 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
33 2820303403 Unclassified Firmicutes Th196P1bin2 Isolate Unclassified
34 2820342392 Unclassified Firmicutes Nt197P3bin64 Isolate Unclassified
35 2820522177 Unclassified Firmicutes Lab288P1bin22 Isolate Unclassified
36 2820541116 Unclassified Firmicutes Lab288P1bin109 Isolate Unclassified
37 2820581541 Unclassified Firmicutes Emb289P3bin127 Isolate Unclassified
38 2820654856 Unclassified Firmicutes Cu122P1bin2 Isolate Unclassified
39 2820702360 Unclassified Firmicutes Co191P1bin4 Isolate Unclassified
40 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
41 2820385248 Unclassified Firmicutes Nt197P1bin19 Isolate Unclassified
42 2820676843 Unclassified Firmicutes Co191P3bin17 Isolate Unclassified
43 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
44 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
45 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
46 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
47 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0415639_059378 3300038395 Bacteria 1762
2 Ga0415639_061655 3300038395 Bacteria 3136
3 Ga0415639_087647 3300038395 Unclassified 6633
4 Ga0466693_063992 3300042592 Bacteria 1595
5 Ga0466693_228946 3300042592 Bacteria 1084
6 Ga0123355_10008263 3300009826 Bacteria 15724
7 Ga0123355_10178599 3300009826 Bacteria 3156
8 Ga0123355_10218862 3300009826 Bacteria 2743
9 Ga0123355_10310103 3300009826 Bacteria 2140
10 Ga0123355_10407626 3300009826 Bacteria 1748
11 Ga0123355_10496654 3300009826 Bacteria 1508
12 Ga0123355_10630429 3300009826 Bacteria 1259
13 Ga0123355_11342219 3300009826 Bacteria 713
14 Ga0123356_10080644 3300010049 Bacteria 3077
15 Ga0123353_10690630 3300010167 Unclassified 1435
16 Ga0123353_10837957 3300010167 Bacteria 1263
17 Ga0415639_000628 3300038395 Bacteria 63096
18 Ga0415639_005328 3300038395 Bacteria 1623
19 Ga0415639_037643 3300038395 Bacteria 9179
20 Ga0415639_044359 3300038395 Bacteria 1999
21 Ga0415639_058984 3300038395 Bacteria 5895
22 Ga0415639_088338 3300038395 Bacteria 4952
23 Ga0466725_206937 3300042654 Bacteria 4710
24 Ga0123355_10000062 3300009826 Bacteria 114407
25 Ga0123355_10000118 3300009826 Bacteria 90212
26 Ga0123355_10001753 3300009826 Bacteria 30327
27 Ga0123353_10014634 3300010167 Bacteria 11324
28 Ga0123353_10024731 3300010167 Bacteria 9126
29 Ga0123353_10116375 3300010167 Bacteria 4302
30 Ga0123353_10116419 3300010167 Bacteria 4301
31 Ga0123353_10501585 3300010167 Bacteria 1768
32 Ga0415639_103229 3300038395 Bacteria 4582
33 Ga0123355_10000180 3300009826 Bacteria 77979
34 Ga0123355_10000311 3300009826 Bacteria 62673
35 Ga0123355_10000810 3300009826 Bacteria 42835
36 Ga0123355_10132348 3300009826 Unclassified 3840
37 Ga0123355_10263090 3300009826 Bacteria 2409
38 Ga0123355_10369377 3300009826 Bacteria 1881
39 Ga0123355_10403900 3300009826 Bacteria 1760
40 Ga0123355_10539854 3300009826 Bacteria 1416
41 Ga0123355_11028540 3300009826 Bacteria 870
42 Ga0123353_10317415 3300010167 Bacteria 2367
43 JGI24695J34938_10001637 3300002450 Bacteria 18695
44 Ga0466714_130685 3300042603 Bacteria 1911
45 Ga0123355_10001661 3300009826 Bacteria 30966
46 Ga0123355_10006689 3300009826 Bacteria 17143
47 Ga0123355_10075887 3300009826 Bacteria 5378
48 Ga0123355_10170677 3300009826 Bacteria 3252
49 Ga0123355_10174681 3300009826 Bacteria 3202
50 Ga0123355_10300902 3300009826 Bacteria 2187
51 Ga0123355_10898238 3300009826 Unclassified 963
52 Ga0123356_12038194 3300010049 Bacteria 716
53 Ga0123353_10045730 3300010167 Bacteria 6950
54 JGI24703J35330_11746571 3300002501 Bacteria 5388
55 Ga0466693_184607 3300042592 Bacteria 2461
56 Ga0466725_344161 3300042654 Bacteria 1014
57 Ga0123357_10651579 3300009784 Unclassified 779
58 Ga0123355_10001920 3300009826 Bacteria 29220
59 Ga0123355_10002208 3300009826 Bacteria 27480
60 Ga0123355_10028385 3300009826 Bacteria 9048
61 Ga0123355_10034260 3300009826 Bacteria 8250
62 Ga0123355_10048313 3300009826 Bacteria 6919
63 Ga0123355_10116513 3300009826 Bacteria 4156
64 Ga0123355_10397090 3300009826 Bacteria 1782
65 Ga0123355_10405587 3300009826 Bacteria 1754
66 Ga0123355_10509656 3300009826 Bacteria 1479
67 Ga0123355_10609917 3300009826 Unclassified 1291
68 Ga0123355_10942082 3300009826 Bacteria 929
69 Ga0123353_10746168 3300010167 Bacteria 1363
70 JGI24703J35330_11747565 3300002501 Bacteria 7304
71 JGI24700J35501_10930583 3300002508 Bacteria 16187
72 Ga0466701_076821 3300042598 Bacteria 4065
73 Ga0466721_043033 3300042608 Bacteria 5521
74 Ga0415639_001150 3300038395 Bacteria 31684
75 Ga0415639_007631 3300038395 Bacteria 2750
76 Ga0123355_10013125 3300009826 Unclassified 12872
77 Ga0123355_10016483 3300009826 Bacteria 11646
78 Ga0123355_10131219 3300009826 Bacteria 3860
79 Ga0123355_10307369 3300009826 Bacteria 2154
80 Ga0123355_10664507 3300009826 Bacteria 1211
81 Ga0123353_10000037 3300010167 Bacteria 145591
82 Ga0123353_10074335 3300010167 Bacteria 5463
83 Ga0123354_10446455 3300010882 Bacteria 1051
84 Ga0466697_187686 3300042611 Bacteria 2194
85 Ga0466698_001569 3300042610 Bacteria 30747
86 Ga0415639_044325 3300038395 Bacteria 1597
87 Ga0415639_192143 3300038395 Bacteria 1615
88 Ga0466693_165299 3300042592 Bacteria 1224
89 Ga0466693_202862 3300042592 Bacteria 2083
90 Ga0466734_157806 3300042623 Bacteria 1234
91 Ga0123355_10000463 3300009826 Bacteria 53565
92 Ga0123355_10001566 3300009826 Bacteria 31924
93 Ga0123355_10030958 3300009826 Bacteria 8679
94 Ga0123355_10040498 3300009826 Bacteria 7583
95 Ga0123356_10001598 3300010049 Bacteria 24871
96 Ga0123353_10843376 3300010167 Bacteria 1257
97 IMNBL1DRAFT_c0001461 3300000062 Bacteria 17666
98 JGI24695J34938_10000024 3300002450 Bacteria 109661
99 JGI24703J35330_11748694 3300002501 Bacteria 25623
100 Ga0466719_104678 3300042606 Bacteria 18699
101 Ga0466721_003109 3300042608 Bacteria 1699
102 Ga0466721_216600 3300042608 Bacteria 10727
103 Ga0123355_10000035 3300009826 Bacteria 135705
104 Ga0123355_10000137 3300009826 Bacteria 86760
105 Ga0123355_10043576 3300009826 Bacteria 7301
106 Ga0123355_10430951 3300009826 Unclassified 1677
107 Ga0123355_10536187 3300009826 Unclassified 1423
108 Ga0123356_12414591 3300010049 Unclassified 658
109 Ga0123353_10391789 3300010167 Bacteria 2072
110 Ga0123353_10482674 3300010167 Bacteria 1813
111 IMNBL1DRAFT_c0000390 3300000062 Bacteria 37618
112 JGI24703J35330_11205001 3300002501 Bacteria 765

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF08909 DUF1854 Domain of unknown function (DUF1854) 49 186 0.91

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.