Protein Family IF02589
Metagenome
Isolate
148
Members
31
Samples
141
Scaffolds
225.48
Avg Length
Representative Sequence
- ID
- 3300009826|Ga0123355_10888023|Ga0123355_108880232
- Length
- 220 aa
- Sequence
- MSVLTLNNVTYKYDGAKNNVLKGVSASFEAGKIYAIVGKSGSGKSTLLSLIAGLDVCTDGKILHGEADLKEIDRDKYRAKEIGVVFQAFNLITNSTAIDNIVLSMQISGLLYVKKSFAYELLQKVGIDKETASRKVLKLSGGEQQRVGIARALAHNPEIIIADEPTGNLDTDTENDVLKILTSLAHNEGKCVIIVTHSKKVSSVADVTLGMKDGKLSSI*
Sample Types
Isolate
4.7%
Metagenome
95.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
53.3%
Unclassified
23.3%
Kalotermitidae
10.0%
Rhinotermitidae
6.7%
Passalidae
6.7%
Taxonomy
Archaea
1
Bacteria
142
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 3 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 4 | 2820321184 | Unclassified Firmicutes Nt197P3bin86 | Isolate | Unclassified |
| 5 | 2820541116 | Unclassified Firmicutes Lab288P1bin109 | Isolate | Unclassified |
| 6 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 7 | 2820587002 | Unclassified Firmicutes Emb289P1bin94 | Isolate | Unclassified |
| 8 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 9 | 2820435670 | Unclassified Firmicutes Lab288P3bin217 | Isolate | Unclassified |
| 10 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 11 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 12 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 13 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 14 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 15 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 16 | 2820378768 | Unclassified Firmicutes Nt197P1bin7 | Isolate | Unclassified |
| 17 | 2820444930 | Unclassified Firmicutes Lab288P3bin199 | Isolate | Unclassified |
| 18 | 2820580397 | Unclassified Firmicutes Emb289P3bin133 | Isolate | Unclassified |
| 19 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 20 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 21 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 22 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 23 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 24 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 25 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 26 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 27 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 28 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 29 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 30 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 31 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123355_10565928 | 3300009826 | Bacteria | 1366 |
| 2 | Ga0123356_10057791 | 3300010049 | Bacteria | 3616 |
| 3 | Ga0123353_10129108 | 3300010167 | Bacteria | 4058 |
| 4 | Ga0123353_10132324 | 3300010167 | Bacteria | 4002 |
| 5 | Ga0123353_10167572 | 3300010167 | Bacteria | 3490 |
| 6 | Ga0123353_10185156 | 3300010167 | Bacteria | 3293 |
| 7 | Ga0123353_10236821 | 3300010167 | Bacteria | 2840 |
| 8 | Ga0123353_10292546 | 3300010167 | Bacteria | 2492 |
| 9 | Ga0123353_10316566 | 3300010167 | Bacteria | 2371 |
| 10 | Ga0123353_10548671 | 3300010167 | Bacteria | 1668 |
| 11 | Ga0123353_11002162 | 3300010167 | Bacteria | 1122 |
| 12 | Ga0466703_003845 | 3300042636 | Bacteria | 3199 |
| 13 | Ga0466717_138637 | 3300042604 | Bacteria | 1484 |
| 14 | Ga0466717_272113 | 3300042604 | Bacteria | 1664 |
| 15 | Ga0466721_254245 | 3300042608 | Bacteria | 2190 |
| 16 | 2227430795 | 2225789004 | Bacteria | 5569 |
| 17 | IMNBL1DRAFT_c0000074 | 3300000062 | Bacteria | 89985 |
| 18 | IMNBL1DRAFT_c0013942 | 3300000062 | Bacteria | 3575 |
| 19 | Ga0415639_123007 | 3300038395 | Bacteria | 1651 |
| 20 | Ga0466694_082188 | 3300042594 | Bacteria | 3131 |
| 21 | Ga0466699_178652 | 3300042597 | Bacteria | 1178 |
| 22 | Ga0123355_10035699 | 3300009826 | Bacteria | 8080 |
| 23 | Ga0123355_10544625 | 3300009826 | Bacteria | 1406 |
| 24 | Ga0123355_10576111 | 3300009826 | Bacteria | 1348 |
| 25 | Ga0123356_10064907 | 3300010049 | Bacteria | 3414 |
| 26 | Ga0123353_10006333 | 3300010167 | Unclassified | 15742 |
| 27 | Ga0123353_10015564 | 3300010167 | Bacteria | 11062 |
| 28 | Ga0123353_10057187 | 3300010167 | Bacteria | 6246 |
| 29 | Ga0123353_10257378 | 3300010167 | Bacteria | 2699 |
| 30 | Ga0123353_10279080 | 3300010167 | Bacteria | 2567 |
| 31 | Ga0123353_10280414 | 3300010167 | Bacteria | 2560 |
| 32 | Ga0123353_10281646 | 3300010167 | Bacteria | 2553 |
| 33 | Ga0123353_10499069 | 3300010167 | Bacteria | 1774 |
| 34 | Ga0123353_10734108 | 3300010167 | Bacteria | 1378 |
| 35 | Ga0123353_10850804 | 3300010167 | Bacteria | 1250 |
| 36 | Ga0466717_300670 | 3300042604 | Bacteria | 1468 |
| 37 | Ga0466722_005889 | 3300042609 | Bacteria | 8133 |
| 38 | IMNBL1DRAFT_c0001148 | 3300000062 | Bacteria | 20275 |
| 39 | Ga0466705_136140 | 3300042612 | Bacteria | 3902 |
| 40 | Ga0123355_10012051 | 3300009826 | Bacteria | 13377 |
| 41 | Ga0123355_10586265 | 3300009826 | Bacteria | 1330 |
| 42 | Ga0123356_10080584 | 3300010049 | Bacteria | 3078 |
| 43 | Ga0123356_10094969 | 3300010049 | Bacteria | 2849 |
| 44 | Ga0123356_10189472 | 3300010049 | Bacteria | 2086 |
| 45 | Ga0123356_10452284 | 3300010049 | Bacteria | 1432 |
| 46 | Ga0123353_10022639 | 3300010167 | Bacteria | 9483 |
| 47 | Ga0123353_10140996 | 3300010167 | Bacteria | 3861 |
| 48 | Ga0123353_10297799 | 3300010167 | Bacteria | 2465 |
| 49 | Ga0123353_10701783 | 3300010167 | Bacteria | 1420 |
| 50 | Ga0123354_10049807 | 3300010882 | Bacteria | 6348 |
| 51 | Ga0466729_214949 | 3300042621 | Bacteria | 1202 |
| 52 | Ga0466731_047758 | 3300042622 | Archaea | 1238 |
| 53 | Ga0466721_209720 | 3300042608 | Bacteria | 1136 |
| 54 | Ga0466722_081567 | 3300042609 | Bacteria | 14710 |
| 55 | Ga0466698_224306 | 3300042610 | Bacteria | 1208 |
| 56 | JGI24703J35330_11718788 | 3300002501 | Bacteria | 2337 |
| 57 | Ga0072941_1087566 | 3300005201 | Bacteria | 4197 |
| 58 | Ga0415639_018286 | 3300038395 | Bacteria | 4015 |
| 59 | Ga0466695_111632 | 3300042595 | Bacteria | 5140 |
| 60 | Ga0123355_10176020 | 3300009826 | Bacteria | 3186 |
| 61 | Ga0123355_10211955 | 3300009826 | Unclassified | 2805 |
| 62 | Ga0123355_10362623 | 3300009826 | Bacteria | 1907 |
| 63 | Ga0123355_10888023 | 3300009826 | Bacteria | 971 |
| 64 | Ga0123353_10028661 | 3300010167 | Bacteria | 8561 |
| 65 | Ga0123353_10029121 | 3300010167 | Bacteria | 8503 |
| 66 | Ga0123353_10106580 | 3300010167 | Bacteria | 4516 |
| 67 | Ga0123353_10199771 | 3300010167 | Bacteria | 3147 |
| 68 | Ga0123353_10273019 | 3300010167 | Bacteria | 2603 |
| 69 | Ga0123353_11773108 | 3300010167 | Bacteria | 769 |
| 70 | Ga0123354_10191910 | 3300010882 | Bacteria | 2283 |
| 71 | Ga0466700_374519 | 3300042600 | Bacteria | 1335 |
| 72 | Ga0466717_137131 | 3300042604 | Bacteria | 4447 |
| 73 | Ga0466721_113975 | 3300042608 | Bacteria | 2886 |
| 74 | JGI24703J35330_11380018 | 3300002501 | Bacteria | 935 |
| 75 | JGI24703J35330_11738912 | 3300002501 | Unclassified | 3243 |
| 76 | Ga0466705_226688 | 3300042612 | Unclassified | 1270 |
| 77 | Ga0123355_10239315 | 3300009826 | Bacteria | 2575 |
| 78 | Ga0123355_10611346 | 3300009826 | Bacteria | 1289 |
| 79 | Ga0123356_10089039 | 3300010049 | Bacteria | 2936 |
| 80 | Ga0123356_10361808 | 3300010049 | Bacteria | 1578 |
| 81 | Ga0123356_10963410 | 3300010049 | Bacteria | 1024 |
| 82 | Ga0123353_10082094 | 3300010167 | Bacteria | 5184 |
| 83 | Ga0123353_10304130 | 3300010167 | Bacteria | 2432 |
| 84 | Ga0123353_10580922 | 3300010167 | Bacteria | 1608 |
| 85 | Ga0466731_414864 | 3300042622 | Bacteria | 3361 |
| 86 | 2227176656 | 2225789004 | Bacteria | 1506 |
| 87 | 2227646822 | 2225789004 | Bacteria | 44148 |
| 88 | 2227669346 | 2225789004 | Bacteria | 1906 |
| 89 | IMNBL1DRAFT_c0000631 | 3300000062 | Bacteria | 28146 |
| 90 | Ga0466694_263355 | 3300042594 | Bacteria | 1002 |
| 91 | Ga0466705_304599 | 3300042612 | Bacteria | 10838 |
| 92 | Ga0123355_10083762 | 3300009826 | Bacteria | 5082 |
| 93 | Ga0123355_10137360 | 3300009826 | Bacteria | 3751 |
| 94 | Ga0123355_11008340 | 3300009826 | Bacteria | 883 |
| 95 | Ga0123356_10022777 | 3300010049 | Bacteria | 5909 |
| 96 | Ga0123356_10097470 | 3300010049 | Bacteria | 2814 |
| 97 | Ga0123356_10302262 | 3300010049 | Bacteria | 1705 |
| 98 | Ga0123353_10000117 | 3300010167 | Bacteria | 93955 |
| 99 | Ga0123353_10002033 | 3300010167 | Bacteria | 24971 |
| 100 | Ga0123353_10209118 | 3300010167 | Bacteria | 3062 |
| 101 | Ga0123353_10594936 | 3300010167 | Bacteria | 1583 |
| 102 | Ga0123353_10738197 | 3300010167 | Bacteria | 1373 |
| 103 | Ga0123353_11007749 | 3300010167 | Bacteria | 1118 |
| 104 | Ga0466731_059650 | 3300042622 | Bacteria | 2178 |
| 105 | Ga0466731_344455 | 3300042622 | Bacteria | 1306 |
| 106 | Ga0466721_117604 | 3300042608 | Bacteria | 6437 |
| 107 | Ga0466715_085164 | 3300042616 | Bacteria | 12801 |
| 108 | 2227619045 | 2225789004 | Bacteria | 46599 |
| 109 | Ga0466657_161269 | 3300042582 | Bacteria | 2754 |
| 110 | Ga0466694_174057 | 3300042594 | Bacteria | 5688 |
| 111 | Ga0123355_10051539 | 3300009826 | Bacteria | 6679 |
| 112 | Ga0123355_10300516 | 3300009826 | Bacteria | 2189 |
| 113 | Ga0123355_10378954 | 3300009826 | Bacteria | 1845 |
| 114 | Ga0123355_11064036 | 3300009826 | Bacteria | 848 |
| 115 | Ga0123356_10324630 | 3300010049 | Bacteria | 1654 |
| 116 | Ga0123353_10094938 | 3300010167 | Bacteria | 4805 |
| 117 | Ga0123353_10238899 | 3300010167 | Bacteria | 2825 |
| 118 | Ga0123353_10659661 | 3300010167 | Bacteria | 1479 |
| 119 | Ga0123353_10867601 | 3300010167 | Bacteria | 1234 |
| 120 | Ga0123353_10895905 | 3300010167 | Bacteria | 1208 |
| 121 | Ga0123353_11179560 | 3300010167 | Bacteria | 1007 |
| 122 | Ga0466721_151753 | 3300042608 | Bacteria | 1077 |
| 123 | 2227535735 | 2225789004 | Bacteria | 56787 |
| 124 | IMNBL1DRAFT_c0003574 | 3300000062 | Bacteria | 9865 |
| 125 | IMNBL1DRAFT_c0014159 | 3300000062 | Bacteria | 3539 |
| 126 | Ga0415639_032696 | 3300038395 | Bacteria | 2340 |
| 127 | Ga0123355_10087656 | 3300009826 | Bacteria | 4945 |
| 128 | Ga0123355_10729318 | 3300009826 | Bacteria | 1128 |
| 129 | Ga0123356_10033977 | 3300010049 | Bacteria | 4770 |
| 130 | Ga0123356_10728490 | 3300010049 | Unclassified | 1161 |
| 131 | Ga0123353_10001974 | 3300010167 | Bacteria | 25318 |
| 132 | Ga0123353_10010339 | 3300010167 | Bacteria | 12995 |
| 133 | Ga0123353_10130551 | 3300010167 | Bacteria | 4032 |
| 134 | Ga0123353_10189245 | 3300010167 | Bacteria | 3250 |
| 135 | Ga0123353_10504101 | 3300010167 | Bacteria | 1762 |
| 136 | Ga0123353_10553566 | 3300010167 | Bacteria | 1658 |
| 137 | Ga0123353_10895729 | 3300010167 | Bacteria | 1209 |
| 138 | Ga0466721_117319 | 3300042608 | Bacteria | 2372 |
| 139 | Ga0466721_397985 | 3300042608 | Bacteria | 4687 |
| 140 | Ga0466693_000497 | 3300042592 | Bacteria | 18576 |
| 141 | Ga0466694_368928 | 3300042594 | Bacteria | 1090 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00005 | ABC_tran | ABC transporter | 21 | 166 | 0.93 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.