Protein Family IF02564
Metagenome
Isolate
129
Members
52
Samples
124
Scaffolds
240.32
Avg Length
Representative Sequence
- ID
- 3300009826|Ga0123355_10524188|Ga0123355_105241882
- Length
- 277 aa
- Sequence
- LGFNAKDEYTINTPHTKYQEYRQVGQCKHHTFFGGMHMTQKQQVISIMKQLGGFATFGKLNQTIDFTSWKTKTPEASVRRIVQNSPEIFRIKPGLWGLKEFEQDILQNLNLKNFSNDTSEDVEFTHTYYQGLVVEVGNLLNMTTFVPNQDKNKLFLGKSLGELSNLHEIHQFAYPELMRHARTVDVIWFNERRMPHAFFEIEHSTDIQNSLVKFYELQDFNAEFNIVADEYRHRKFTDLLNRSIFKPIRERVKFKSYANLVDAHSKPFKHAHAFAL*
Sample Types
Isolate
3.9%
Metagenome
96.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
43.1%
Kalotermitidae
25.5%
Unclassified
15.7%
Termopsidae
7.8%
Rhinotermitidae
3.9%
Hodotermitidae
2.0%
Passalidae
2.0%
Taxonomy
Archaea
4
Bacteria
113
Eukaryota
0
Viruses
0
Unclassified
12
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 2 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 3 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 6 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 11 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 12 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 13 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 14 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 15 | 2820405014 | Unclassified Firmicutes Lab288P4bin88 | Isolate | Unclassified |
| 16 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 17 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 18 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 19 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 20 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 21 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 22 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 23 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 24 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 25 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 26 | 2820744581 | Unclassified Bacteroidetes Th196P3bin138 | Isolate | Unclassified |
| 27 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 28 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 29 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 30 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 31 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 32 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 33 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 34 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 35 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 36 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 37 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 38 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 39 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 40 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 41 | 2773857687 | Unclassified Methanosarcinaceae Lab288P3bin190 | Isolate | Unclassified |
| 42 | 2820768849 | Unclassified Bacteroidetes Lab288P3bin194 | Isolate | Unclassified |
| 43 | 2820774381 | Unclassified Bacteroidetes Lab288P1bin37 | Isolate | Unclassified |
| 44 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 45 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 46 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 47 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 48 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 49 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 50 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 51 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 52 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466695_165950 | 3300042595 | Bacteria | 7110 |
| 2 | Ga0466699_006188 | 3300042597 | Bacteria | 3106 |
| 3 | Ga0466699_243462 | 3300042597 | Bacteria | 1289 |
| 4 | Ga0466702_310168 | 3300042635 | Bacteria | 1568 |
| 5 | Ga0466704_388884 | 3300042643 | Bacteria | 7394 |
| 6 | Ga0466708_134728 | 3300042652 | Bacteria | 9560 |
| 7 | Ga0123355_10524188 | 3300009826 | Bacteria | 1448 |
| 8 | Ga0466706_065840 | 3300042599 | Bacteria | 17570 |
| 9 | Ga0466707_420326 | 3300042601 | Bacteria | 1734 |
| 10 | Ga0466722_144652 | 3300042609 | Bacteria | 1163 |
| 11 | AustNasuHG_c1047930 | 3300000089 | Bacteria | 946 |
| 12 | JGI24695J34938_10024714 | 3300002450 | Bacteria | 2882 |
| 13 | JGI24702J35022_10019439 | 3300002462 | Bacteria | 3694 |
| 14 | Ga0068302_10101538 | 3300005071 | Bacteria | 3779 |
| 15 | Ga0068305_10014803 | 3300005083 | Unclassified | 2231 |
| 16 | Ga0466711_328884 | 3300042615 | Bacteria | 1169 |
| 17 | Ga0466726_015891 | 3300042619 | Bacteria | 1207 |
| 18 | Ga0466726_245125 | 3300042619 | Bacteria | 4112 |
| 19 | Ga0466727_010763 | 3300042655 | Bacteria | 1308 |
| 20 | Ga0123353_10104427 | 3300010167 | Archaea | 4566 |
| 21 | Ga0123353_10540083 | 3300010167 | Bacteria | 1685 |
| 22 | Ga0123354_10318955 | 3300010882 | Bacteria | 1437 |
| 23 | Ga0466706_006960 | 3300042599 | Bacteria | 2062 |
| 24 | Ga0466706_009321 | 3300042599 | Unclassified | 1051 |
| 25 | Ga0466706_268003 | 3300042599 | Bacteria | 9970 |
| 26 | Ga0466713_012307 | 3300042602 | Bacteria | 58290 |
| 27 | Ga0466713_137954 | 3300042602 | Bacteria | 12736 |
| 28 | Ga0466722_074372 | 3300042609 | Bacteria | 9872 |
| 29 | JGI24702J35022_10051456 | 3300002462 | Bacteria | 2195 |
| 30 | Ga0072941_1417177 | 3300005201 | Bacteria | 3007 |
| 31 | Ga0466723_084719 | 3300042618 | Bacteria | 1281 |
| 32 | Ga0466705_019719 | 3300042612 | Bacteria | 32377 |
| 33 | Ga0466705_267795 | 3300042612 | Bacteria | 1912 |
| 34 | Ga0466705_308152 | 3300042612 | Bacteria | 62248 |
| 35 | Ga0466692_112435 | 3300042591 | Bacteria | 72698 |
| 36 | Ga0466691_117696 | 3300042593 | Bacteria | 12066 |
| 37 | Ga0466696_012344 | 3300042596 | Bacteria | 1482 |
| 38 | Ga0123353_10491718 | 3300010167 | Bacteria | 1791 |
| 39 | Ga0466706_100414 | 3300042599 | Bacteria | 3680 |
| 40 | Ga0466706_269353 | 3300042599 | Bacteria | 2712 |
| 41 | Ga0466722_077664 | 3300042609 | Unclassified | 1541 |
| 42 | JGI24699J35502_11126481 | 3300002509 | Bacteria | 3970 |
| 43 | Ga0068305_10675912 | 3300005083 | Bacteria | 953 |
| 44 | Ga0072940_1214422 | 3300005200 | Bacteria | 1849 |
| 45 | Ga0466715_639974 | 3300042616 | Bacteria | 2277 |
| 46 | Ga0466723_262606 | 3300042618 | Bacteria | 1240 |
| 47 | Ga0466690_156524 | 3300042590 | Unclassified | 1302 |
| 48 | Ga0466694_402155 | 3300042594 | Bacteria | 1369 |
| 49 | Ga0466731_122135 | 3300042622 | Bacteria | 1602 |
| 50 | Ga0466735_120888 | 3300042624 | Bacteria | 2194 |
| 51 | Ga0466703_008086 | 3300042636 | Bacteria | 2256 |
| 52 | Ga0466704_372188 | 3300042643 | Bacteria | 2955 |
| 53 | Ga0466704_486246 | 3300042643 | Bacteria | 1364 |
| 54 | Ga0466727_211131 | 3300042655 | Bacteria | 3410 |
| 55 | Ga0123353_10000163 | 3300010167 | Bacteria | 85022 |
| 56 | Ga0123354_10060575 | 3300010882 | Bacteria | 5596 |
| 57 | Ga0123354_10177248 | 3300010882 | Bacteria | 2450 |
| 58 | Ga0466701_089428 | 3300042598 | Bacteria | 9441 |
| 59 | Ga0466706_093911 | 3300042599 | Bacteria | 46548 |
| 60 | Ga0466706_232425 | 3300042599 | Unclassified | 2304 |
| 61 | Ga0466707_172184 | 3300042601 | Bacteria | 3747 |
| 62 | Ga0466707_311707 | 3300042601 | Bacteria | 4167 |
| 63 | Ga0466713_014637 | 3300042602 | Bacteria | 1041 |
| 64 | Ga0466719_424790 | 3300042606 | Bacteria | 5930 |
| 65 | Ga0466722_123609 | 3300042609 | Bacteria | 20553 |
| 66 | JGI24695J34938_10057732 | 3300002450 | Bacteria | 1667 |
| 67 | Ga0466711_060218 | 3300042615 | Bacteria | 22953 |
| 68 | Ga0466693_339779 | 3300042592 | Bacteria | 5257 |
| 69 | Ga0466704_270507 | 3300042643 | Bacteria | 6406 |
| 70 | Ga0466727_073944 | 3300042655 | Bacteria | 1260 |
| 71 | Ga0123355_10531409 | 3300009826 | Bacteria | 1433 |
| 72 | Ga0123353_10023725 | 3300010167 | Bacteria | 9294 |
| 73 | Ga0466706_140343 | 3300042599 | Bacteria | 15711 |
| 74 | Ga0466706_145370 | 3300042599 | Bacteria | 23122 |
| 75 | Ga0466706_189902 | 3300042599 | Bacteria | 1470 |
| 76 | Ga0466706_252240 | 3300042599 | Bacteria | 2383 |
| 77 | Ga0466713_017731 | 3300042602 | Bacteria | 33130 |
| 78 | Ga0466715_042405 | 3300042616 | Bacteria | 42589 |
| 79 | Ga0466715_202193 | 3300042616 | Bacteria | 20119 |
| 80 | Ga0466718_074037 | 3300042617 | Bacteria | 1152 |
| 81 | Ga0466726_001498 | 3300042619 | Unclassified | 1233 |
| 82 | Ga0466728_025987 | 3300042620 | Bacteria | 11542 |
| 83 | Ga0466733_192721 | 3300042659 | Archaea | 142782 |
| 84 | Ga0466690_341105 | 3300042590 | Bacteria | 5899 |
| 85 | Ga0466692_127706 | 3300042591 | Bacteria | 4001 |
| 86 | Ga0466703_216161 | 3300042636 | Bacteria | 5346 |
| 87 | Ga0466727_192878 | 3300042655 | Unclassified | 1531 |
| 88 | Ga0466701_043991 | 3300042598 | Bacteria | 4160 |
| 89 | Ga0466707_025767 | 3300042601 | Bacteria | 5170 |
| 90 | Ga0466717_211244 | 3300042604 | Bacteria | 1083 |
| 91 | Ga0466716_272582 | 3300042605 | Bacteria | 1357 |
| 92 | Ga0466719_186854 | 3300042606 | Bacteria | 1053 |
| 93 | Ga0466722_152815 | 3300042609 | Bacteria | 1182 |
| 94 | 2227391368 | 2225789004 | Unclassified | 1085 |
| 95 | Ga0466718_098112 | 3300042617 | Unclassified | 1429 |
| 96 | Ga0466718_139234 | 3300042617 | Bacteria | 1267 |
| 97 | Ga0466732_204290 | 3300042656 | Bacteria | 3710 |
| 98 | Ga0466734_076534 | 3300042623 | Bacteria | 2157 |
| 99 | Ga0466734_116397 | 3300042623 | Bacteria | 6416 |
| 100 | Ga0466704_465653 | 3300042643 | Bacteria | 2165 |
| 101 | Ga0123356_11413474 | 3300010049 | Unclassified | 856 |
| 102 | Ga0123354_10385165 | 3300010882 | Bacteria | 1205 |
| 103 | Ga0466706_036961 | 3300042599 | Bacteria | 15127 |
| 104 | Ga0466706_284523 | 3300042599 | Unclassified | 1856 |
| 105 | Ga0466713_038282 | 3300042602 | Bacteria | 1764 |
| 106 | Ga0466719_394108 | 3300042606 | Unclassified | 1486 |
| 107 | JGI24702J35022_10036475 | 3300002462 | Bacteria | 2627 |
| 108 | Ga0466715_017908 | 3300042616 | Bacteria | 3089 |
| 109 | Ga0466726_019139 | 3300042619 | Bacteria | 13843 |
| 110 | Ga0466726_194946 | 3300042619 | Bacteria | 1218 |
| 111 | Ga0466726_426606 | 3300042619 | Bacteria | 1691 |
| 112 | Ga0466705_054920 | 3300042612 | Bacteria | 5189 |
| 113 | Ga0466704_161197 | 3300042643 | Bacteria | 11980 |
| 114 | Ga0123355_10759930 | 3300009826 | Bacteria | 1093 |
| 115 | Ga0123356_11439224 | 3300010049 | Bacteria | 848 |
| 116 | Ga0466701_038136 | 3300042598 | Bacteria | 1538 |
| 117 | Ga0466706_018155 | 3300042599 | Bacteria | 6258 |
| 118 | Ga0466706_243391 | 3300042599 | Bacteria | 1681 |
| 119 | Ga0466713_070780 | 3300042602 | Bacteria | 1365 |
| 120 | Ga0466722_019647 | 3300042609 | Bacteria | 2831 |
| 121 | Ga0466698_430423 | 3300042610 | Bacteria | 1071 |
| 122 | Ga0466711_307176 | 3300042615 | Bacteria | 1032 |
| 123 | Ga0466715_044737 | 3300042616 | Bacteria | 2477 |
| 124 | Ga0466715_247096 | 3300042616 | Archaea | 3872 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.