Protein Family IF02547

Metagenome Isolate
222 Members
81 Samples
189 Scaffolds
181.97 Avg Length

🧬 Representative Sequence

ID
3300009826|Ga0123355_10382256|Ga0123355_103822563
Length
187 aa
Sequence
MIMKKFVCVVCGYVHEGDTPPEQCPICHVPASKFNEMAETEGLQFADEHRVGIAKDVAEPEIIETLRQEFIGECTEVGMYLAMSRQADREGYPEVAEAYKRIAYEEADHAARYAEMLGEVVSASTKKNLEARMMAEHGATQGKLDLARKAKQLNYDAIHDSVHEMCKDEARHGKAFQGLLNRYFGE*

📊 Sample Types

Isolate 14.9%
Metagenome 85.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 43.8%
Termitidae 32.5%
Kalotermitidae 15.0%
Rhinotermitidae 3.8%
Termopsidae 3.8%
Passalidae 1.2%

🌳 Taxonomy

Archaea 0
Bacteria 193
Eukaryota 0
Viruses 0
Unclassified 29

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820004052 Unclassified Synergistetes Nt197P3bin25 Isolate Unclassified
2 2820205024 Unclassified Planctomycetes Cu122P4bin3 Isolate Unclassified
3 2820275298 Unclassified Firmicutes Th196P3bin17 Isolate Unclassified
4 2820339298 Unclassified Firmicutes Nt197P3bin68 Isolate Unclassified
5 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
6 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
7 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
8 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
9 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
10 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
11 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
12 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
13 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
14 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
15 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
16 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
17 2820021908 Unclassified Spirochaetes Lab288P4bin6 Isolate Unclassified
18 2820319488 Unclassified Firmicutes Nt197P3bin88 Isolate Unclassified
19 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
20 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
21 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
22 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
23 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
24 2781125685 Treponema sp. Lab288P1bin13 Isolate Unclassified
25 2820551407 Unclassified Firmicutes Emb289P4bin38 Isolate Unclassified
26 2820669764 Unclassified Firmicutes Co191P3bin30 Isolate Unclassified
27 2820685979 Unclassified Firmicutes Co191P1bin81 Isolate Unclassified
28 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
29 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
30 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
31 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
32 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
33 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
34 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
35 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
36 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
37 2820924633 Unclassified Actinobacteria Emb289P3bin142 Isolate Unclassified
38 2820027804 Unclassified Spirochaetes Lab288P1bin105 Isolate Unclassified
39 2820347164 Unclassified Firmicutes Nt197P3bin58 Isolate Unclassified
40 2820356982 Unclassified Firmicutes Nt197P3bin19 Isolate Unclassified
41 2820432912 Unclassified Firmicutes Lab288P3bin219 Isolate Unclassified
42 2820530790 Unclassified Firmicutes Lab288P1bin141 Isolate Unclassified
43 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
44 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
45 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
46 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
47 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
48 2820068815 Unclassified Proteobacteria Nt197P3bin4 Isolate Unclassified
49 2820340373 Unclassified Firmicutes Nt197P3bin67 Isolate Unclassified
50 2820373881 Unclassified Firmicutes Nt197P3bin10 Isolate Unclassified
51 2820573558 Unclassified Firmicutes Emb289P3bin140 Isolate Unclassified
52 2820647881 Unclassified Firmicutes Cu122P5bin16 Isolate Unclassified
53 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
54 2820023741 Unclassified Spirochaetes Lab288P3bin165 Isolate Unclassified
55 2820263778 Unclassified Firmicutes Th196P3bin37 Isolate Unclassified
56 2820520043 Unclassified Firmicutes Lab288P1bin24 Isolate Unclassified
57 2820611732 Unclassified Firmicutes Emb289P1bin19 Isolate Unclassified
58 2820673891 Unclassified Firmicutes Co191P3bin18 Isolate Unclassified
59 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
60 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
61 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
62 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
63 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
64 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
65 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
66 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
67 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
68 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
69 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
70 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
71 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
72 2820217359 Unclassified Kiritimatiellaeota Nt197P3bin101 Isolate Unclassified
73 2820387566 Unclassified Firmicutes Nt197P1bin1 Isolate Unclassified
74 2820510699 Unclassified Firmicutes Lab288P1bin40 Isolate Unclassified
75 2820526825 Unclassified Firmicutes Lab288P1bin16 Isolate Unclassified
76 2820596822 Unclassified Firmicutes Emb289P1bin58 Isolate Unclassified
77 2820644600 Unclassified Firmicutes Cu122P5bin39 Isolate Unclassified
78 2820679524 Unclassified Firmicutes Co191P1bin94 Isolate Unclassified
79 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
80 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
81 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123355_10001953 3300009826 Bacteria 29084
2 Ga0123355_10796664 3300009826 Bacteria 1055
3 Ga0123356_10040484 3300010049 Bacteria 4342
4 Ga0123356_11704868 3300010049 Bacteria 782
5 Ga0123353_10093851 3300010167 Bacteria 4835
6 Ga0123353_10595053 3300010167 Bacteria 1582
7 Ga0123353_11220589 3300010167 Bacteria 985
8 Ga0123354_10258538 3300010882 Bacteria 1745
9 Ga0466692_067579 3300042591 Bacteria 11328
10 JGI24695J34938_10007483 3300002450 Bacteria 6388
11 JGI24695J34938_10019416 3300002450 Bacteria 3369
12 JGI24702J35022_10024702 3300002462 Bacteria 3245
13 JGI24705J35276_11878835 3300002504 Bacteria 735
14 Ga0466729_018216 3300042621 Bacteria 8888
15 Ga0466729_119042 3300042621 Bacteria 4875
16 Ga0466702_199956 3300042635 Unclassified 1231
17 Ga0466703_175096 3300042636 Bacteria 2140
18 Ga0466704_140372 3300042643 Bacteria 2811
19 Ga0466725_319019 3300042654 Bacteria 1822
20 Ga0466727_341597 3300042655 Bacteria 2089
21 Ga0466700_189736 3300042600 Bacteria 1334
22 Ga0466700_483655 3300042600 Bacteria 2501
23 Ga0466719_521875 3300042606 Unclassified 1034
24 Ga0466705_254662 3300042612 Bacteria 20021
25 Ga0466705_336692 3300042612 Bacteria 60317
26 Ga0466733_217079 3300042659 Bacteria 4509
27 Ga0123355_10003127 3300009826 Bacteria 23634
28 Ga0123355_10004063 3300009826 Bacteria 21220
29 Ga0123356_10056306 3300010049 Bacteria 3663
30 Ga0123353_10109054 3300010167 Bacteria 4460
31 Ga0123353_10186152 3300010167 Bacteria 3283
32 Ga0123353_10752798 3300010167 Bacteria 1355
33 Ga0466696_462405 3300042596 Bacteria 3598
34 Ga0466701_005317 3300042598 Bacteria 1291
35 JGI24703J35330_11748536 3300002501 Bacteria 18955
36 JGI24705J35276_11669248 3300002504 Bacteria 619
37 JGI24705J35276_12231940 3300002504 Bacteria 4122
38 Ga0466712_067250 3300042614 Unclassified 2544
39 Ga0466715_127950 3300042616 Bacteria 4990
40 Ga0466718_048113 3300042617 Bacteria 1022
41 Ga0466723_199295 3300042618 Bacteria 4766
42 Ga0466723_337679 3300042618 Bacteria 1492
43 Ga0466702_286171 3300042635 Bacteria 1488
44 Ga0466707_058920 3300042601 Bacteria 6804
45 Ga0466707_272259 3300042601 Bacteria 5503
46 Ga0466707_311771 3300042601 Bacteria 7449
47 Ga0466716_349124 3300042605 Unclassified 6324
48 Ga0466719_010713 3300042606 Bacteria 10684
49 Ga0466727_350765 3300042655 Bacteria 5096
50 Ga0123355_10000081 3300009826 Bacteria 101187
51 Ga0123355_10168898 3300009826 Bacteria 3274
52 Ga0123356_10064991 3300010049 Bacteria 3412
53 Ga0123356_10105557 3300010049 Bacteria 2711
54 Ga0123356_10232613 3300010049 Bacteria 1908
55 Ga0123353_10000137 3300010167 Bacteria 88515
56 Ga0123353_10255111 3300010167 Bacteria 2713
57 Ga0123353_10330329 3300010167 Unclassified 2308
58 Ga0123353_10524681 3300010167 Bacteria 1717
59 Ga0123353_11374104 3300010167 Bacteria 910
60 Ga0466691_114394 3300042593 Unclassified 4604
61 JGI24695J34938_10001903 3300002450 Bacteria 16882
62 JGI24705J35276_12200319 3300002504 Bacteria 1600
63 Ga0466705_454206 3300042612 Bacteria 1346
64 Ga0466718_100790 3300042617 Unclassified 2114
65 Ga0466704_005437 3300042643 Unclassified 2512
66 Ga0466725_099644 3300042654 Bacteria 1965
67 Ga0466700_413961 3300042600 Bacteria 1426
68 Ga0466707_334707 3300042601 Bacteria 1894
69 Ga0466722_199241 3300042609 Unclassified 2808
70 Ga0466722_261457 3300042609 Bacteria 10639
71 Ga0123355_10004903 3300009826 Bacteria 19471
72 Ga0123355_10042501 3300009826 Bacteria 7399
73 Ga0123355_10051878 3300009826 Bacteria 6656
74 Ga0123355_10382256 3300009826 Bacteria 1833
75 Ga0123356_10000794 3300010049 Bacteria 35034
76 Ga0123356_10006428 3300010049 Bacteria 11844
77 Ga0123356_10140067 3300010049 Bacteria 2385
78 Ga0123356_11256128 3300010049 Bacteria 905
79 Ga0123356_11288081 3300010049 Bacteria 894
80 Ga0123353_10002835 3300010167 Bacteria 21675
81 Ga0123353_10010662 3300010167 Bacteria 12843
82 Ga0123353_10283748 3300010167 Bacteria 2541
83 Ga0123353_10311579 3300010167 Bacteria 2395
84 Ga0123353_10999247 3300010167 Bacteria 1124
85 Ga0466691_035435 3300042593 Unclassified 2273
86 Ga0466695_130205 3300042595 Bacteria 18597
87 Ga0466696_140716 3300042596 Bacteria 1052
88 Ga0466723_261575 3300042618 Bacteria 2730
89 Ga0466735_155053 3300042624 Bacteria 1315
90 Ga0466704_165757 3300042643 Bacteria 24243
91 Ga0466724_31036 3300042649 Bacteria 3186
92 Ga0466708_104834 3300042652 Bacteria 10718
93 Ga0466725_054344 3300042654 Bacteria 1151
94 Ga0466713_063196 3300042602 Bacteria 62619
95 Ga0466716_017603 3300042605 Bacteria 2305
96 Ga0466722_004360 3300042609 Bacteria 3066
97 Ga0123355_10022460 3300009826 Bacteria 10114
98 Ga0123355_10023403 3300009826 Bacteria 9921
99 Ga0123355_10100548 3300009826 Unclassified 4554
100 Ga0123355_10460678 3300009826 Unclassified 1596
101 Ga0123355_10561789 3300009826 Bacteria 1374
102 Ga0123356_12867719 3300010049 Bacteria 603
103 Ga0123353_10510547 3300010167 Bacteria 1748
104 Ga0123353_11625853 3300010167 Bacteria 814
105 Ga0466656_219442 3300042550 Bacteria 1557
106 Ga0466715_029610 3300042616 Bacteria 14730
107 Ga0466715_173648 3300042616 Unclassified 22036
108 Ga0466715_183506 3300042616 Unclassified 3268
109 Ga0466715_250368 3300042616 Bacteria 1211
110 Ga0466700_049123 3300042600 Bacteria 2034
111 Ga0466719_077355 3300042606 Unclassified 1334
112 Ga0123355_10652033 3300009826 Bacteria 1228
113 Ga0123356_10036247 3300010049 Bacteria 4606
114 Ga0123356_10116042 3300010049 Bacteria 2595
115 Ga0123353_10633260 3300010167 Bacteria 1519
116 Ga0123353_10866492 3300010167 Bacteria 1235
117 Ga0466696_082839 3300042596 Bacteria 1359
118 Ga0466696_117123 3300042596 Bacteria 19530
119 2227386345 2225789004 Bacteria 27406
120 JGI24695J34938_10027127 3300002450 Unclassified 2712
121 Ga0068302_10208162 3300005071 Bacteria 3501
122 Ga0466705_498918 3300042612 Unclassified 14077
123 Ga0466711_428819 3300042615 Bacteria 1942
124 Ga0466711_466899 3300042615 Bacteria 11059
125 Ga0466723_080872 3300042618 Unclassified 4976
126 Ga0466728_195791 3300042620 Unclassified 1419
127 Ga0466728_401321 3300042620 Unclassified 1215
128 Ga0466724_30533 3300042649 Bacteria 1153
129 Ga0466708_082939 3300042652 Unclassified 20882
130 Ga0466713_153818 3300042602 Bacteria 46698
131 Ga0466722_181453 3300042609 Bacteria 39544
132 Ga0123357_10303915 3300009784 Unclassified 1606
133 Ga0123355_10007440 3300009826 Bacteria 16409
134 Ga0123355_10027484 3300009826 Bacteria 9188
135 Ga0123355_10224580 3300009826 Bacteria 2694
136 Ga0123356_10685489 3300010049 Bacteria 1193
137 Ga0123353_10060725 3300010167 Bacteria 6062
138 Ga0123353_10141121 3300010167 Bacteria 3859
139 Ga0123353_10314424 3300010167 Bacteria 2381
140 Ga0123353_10318584 3300010167 Bacteria 2361
141 Ga0123353_10756411 3300010167 Bacteria 1351
142 Ga0123353_10885831 3300010167 Bacteria 1217
143 Ga0123353_11013360 3300010167 Bacteria 1114
144 Ga0123354_10264979 3300010882 Bacteria 1706
145 Ga0466694_041516 3300042594 Bacteria 2124
146 Ga0466696_476089 3300042596 Unclassified 2064
147 JGI24695J34938_10020279 3300002450 Bacteria 3274
148 JGI24696J40584_12823448 3300002834 Bacteria 913
149 Ga0123357_10001015 3300009784 Bacteria 28788
150 Ga0466715_079144 3300042616 Bacteria 7560
151 Ga0466718_031977 3300042617 Bacteria 1274
152 Ga0466703_350382 3300042636 Bacteria 2619
153 Ga0466704_180276 3300042643 Unclassified 1642
154 Ga0466727_023718 3300042655 Unclassified 2167
155 Ga0466700_456349 3300042600 Bacteria 1068
156 Ga0466722_142729 3300042609 Bacteria 2306
157 Ga0466705_184826 3300042612 Bacteria 11891
158 Ga0123355_10046858 3300009826 Bacteria 7029
159 Ga0123355_10138156 3300009826 Bacteria 3738
160 Ga0123355_10143347 3300009826 Bacteria 3649
161 Ga0123355_10180526 3300009826 Bacteria 3134
162 Ga0123355_10207040 3300009826 Bacteria 2851
163 Ga0123355_10212500 3300009826 Bacteria 2800
164 Ga0123355_10228058 3300009826 Bacteria 2665
165 Ga0123356_10054050 3300010049 Bacteria 3739
166 Ga0123356_10249428 3300010049 Bacteria 1852
167 Ga0123356_11450037 3300010049 Bacteria 845
168 Ga0123353_10464038 3300010167 Bacteria 1860
169 Ga0123353_10500604 3300010167 Unclassified 1770
170 Ga0123353_10641307 3300010167 Bacteria 1506
171 Ga0123354_10280150 3300010882 Bacteria 1621
172 Ga0466692_193758 3300042591 Unclassified 1534
173 Ga0466693_315258 3300042592 Bacteria 2092
174 Ga0466695_090343 3300042595 Bacteria 1688
175 Ga0466699_133922 3300042597 Bacteria 2998
176 Ga0072941_1063924 3300005201 Bacteria 6985
177 Ga0466718_027270 3300042617 Bacteria 9483
178 Ga0466728_107856 3300042620 Unclassified 1380
179 Ga0466731_205960 3300042622 Bacteria 1877
180 Ga0466731_412892 3300042622 Bacteria 1205
181 Ga0466734_156281 3300042623 Bacteria 1003
182 Ga0466735_125037 3300042624 Bacteria 1066
183 Ga0466702_150906 3300042635 Bacteria 1473
184 Ga0466703_375648 3300042636 Unclassified 1016
185 Ga0466700_180568 3300042600 Bacteria 2318
186 Ga0466707_311468 3300042601 Bacteria 20339
187 Ga0466707_370563 3300042601 Bacteria 3508
188 Ga0466698_016142 3300042610 Bacteria 1008
189 Ga0466698_179752 3300042610 Bacteria 1042

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF21349 RUBY_RBDX Rubrerythrin, rubredoxin-like domain 6 34 0.96
PF02915 Rubrerythrin Rubrerythrin 64 179 0.92

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.