Protein Family IF02483

Metagenome Isolate
136 Members
61 Samples
104 Scaffolds
299.98 Avg Length

🧬 Representative Sequence

ID
3300009826|Ga0123355_10193211|Ga0123355_101932113
Length
346 aa
Sequence
MYRLKAAKSQGFLMIKFWKGYQGFLLDTILSLVAVYYRWGERMQINRLFEIVYLLMNKKQATANELASHFEVSKRTILRDIDTLTTAGIPIYTTQGKGGGIFIQDNFVLNKTFISEDEKKQILFSLQSMAATEFIETDQVLGRLRNFFASPNKEWIEVDFSRWGHSAADTTKFEMLKNAIINEFAVSFDYLSAYGESKGREVYPLKLSFKSKAWYLQSFCPAENDYRVFKFTRLSNLVVLDKSFKGNDYKAPKIEPPEDPSELCIVDVRLLVSSHAKFRIYDEFAESDIIVNNDGSFTLRMTQGQWIHDYILSYGTAVEVLEPRYIRDEMLVRIDKIRNRYQSKT*

📊 Sample Types

Isolate 23.5%
Metagenome 76.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 28.3%
Unclassified 25.0%
Blattidae 23.3%
Kalotermitidae 15.0%
Passalidae 3.3%
Tenebrionidae 3.3%
Rhinotermitidae 1.7%

🌳 Taxonomy

Archaea 1
Bacteria 131
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820481688 Unclassified Firmicutes Lab288P1bin76 Isolate Unclassified
2 2820512088 Unclassified Firmicutes Lab288P1bin4 Isolate Unclassified
3 2820533259 Unclassified Firmicutes Lab288P1bin140 Isolate Unclassified
4 2820584674 Unclassified Firmicutes Emb289P1bin98 Isolate Unclassified
5 2940292506 Lachnoclostridium sp. PH5-23 Isolate Blattidae
6 2940343849 Breznakia sp. PH5-24 Isolate Blattidae
7 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
8 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
9 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
10 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
11 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
12 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
13 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
14 2820522177 Unclassified Firmicutes Lab288P1bin22 Isolate Unclassified
15 2940286528 Lachnospiraceae bacterium PFB1-21 Isolate Blattidae
16 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
17 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
18 2820329821 Unclassified Firmicutes Nt197P3bin77 Isolate Unclassified
19 2820483401 Unclassified Firmicutes Lab288P1bin74 Isolate Unclassified
20 2820513949 Unclassified Firmicutes Lab288P1bin39 Isolate Unclassified
21 2940339133 Breznakia sp. PF5-3 Isolate Blattidae
22 2820593525 Unclassified Firmicutes Emb289P1bin7 Isolate Unclassified
23 2940230426 Lachnospiraceae bacterium PH5-48 Isolate Blattidae
24 2940283334 Lachnospiraceae bacterium PF1-4 Isolate Blattidae
25 2940295490 Lachnospiraceae bacterium PH1-22 Isolate Blattidae
26 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
27 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
28 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
29 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
30 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
31 2781125632 Treponema sp. Co191P1bin87 Isolate Unclassified
32 2820356982 Unclassified Firmicutes Nt197P3bin19 Isolate Unclassified
33 2820547636 Unclassified Firmicutes Lab288P1bin10 Isolate Unclassified
34 2940233634 Lachnoclostridium sp. PF5-10 Isolate Blattidae
35 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
36 2590828839 Clostridium sp. 1 Isolate Termitidae
37 2820495292 Unclassified Firmicutes Lab288P1bin59 Isolate Unclassified
38 2940236825 Breznakia sp. PM6-1 Isolate Blattidae
39 2940280053 Lachnospiraceae bacterium PF1-22 Isolate Blattidae
40 2940341480 Breznakia sp. PFB2-8 Isolate Blattidae
41 2944625312 Dysgonomonas sp. PF1-3 Isolate Blattidae
42 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
43 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
44 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
45 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
46 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
47 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
48 2593339124 Clostridium sp. 4 Isolate Termitidae
49 2820474468 Unclassified Firmicutes Lab288P1bin84 Isolate Unclassified
50 2820615445 Unclassified Firmicutes Emb289P1bin132 Isolate Unclassified
51 2940289514 Lachnospiraceae bacterium PM6-15 Isolate Blattidae
52 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
53 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
54 2940277027 Lachnospiraceae bacterium PF1-21 Isolate Blattidae
55 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
56 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
57 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
58 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
59 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
60 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
61 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0562379_0064 3300056790 Bacteria 452272
2 Ga0123355_10000965 3300009826 Bacteria 39761
3 Ga0123355_10015228 3300009826 Bacteria 12073
4 Ga0123355_10220743 3300009826 Bacteria 2726
5 Ga0123355_10732789 3300009826 Bacteria 1124
6 Ga0466716_492932 3300042605 Unclassified 1617
7 Ga0466715_097473 3300042616 Bacteria 1865
8 Ga0466715_617329 3300042616 Bacteria 16696
9 Ga0466709_078717 3300042648 Bacteria 6901
10 Ga0466725_203587 3300042654 Bacteria 1033
11 Ga0123355_10041088 3300009826 Bacteria 7529
12 Ga0123355_10060172 3300009826 Bacteria 6134
13 Ga0123355_10075928 3300009826 Bacteria 5377
14 Ga0123355_10167340 3300009826 Bacteria 3295
15 Ga0123355_10248376 3300009826 Archaea 2509
16 Ga0123355_10388387 3300009826 Bacteria 1811
17 Ga0123355_10501020 3300009826 Bacteria 1498
18 Ga0123356_10503302 3300010049 Bacteria 1368
19 Ga0123354_10200204 3300010882 Bacteria 2198
20 JGI24695J34938_10036542 3300002450 Bacteria 2238
21 JGI24703J35330_11684035 3300002501 Bacteria 1837
22 Ga0466703_217589 3300042636 Bacteria 1812
23 Ga0466704_547465 3300042643 Bacteria 6276
24 Ga0123355_10000924 3300009826 Bacteria 40681
25 Ga0123355_10001109 3300009826 Bacteria 37241
26 Ga0123355_10002055 3300009826 Bacteria 28435
27 Ga0123355_10019617 3300009826 Bacteria 10769
28 Ga0123355_10395229 3300009826 Bacteria 1788
29 Ga0123356_10096108 3300010049 Bacteria 2833
30 Ga0123353_10059845 3300010167 Bacteria 6109
31 Ga0123355_10000097 3300009826 Bacteria 93968
32 Ga0123355_10025121 3300009826 Bacteria 9590
33 Ga0123355_10040942 3300009826 Bacteria 7542
34 Ga0123355_10124591 3300009826 Bacteria 3986
35 Ga0123353_10912598 3300010167 Bacteria 1194
36 Ga0123354_10269868 3300010882 Bacteria 1677
37 Ga0466694_229138 3300042594 Bacteria 15188
38 Ga0466705_053439 3300042612 Bacteria 1802
39 Ga0123355_10005414 3300009826 Bacteria 18679
40 Ga0123355_10016376 3300009826 Bacteria 11682
41 Ga0123355_10229795 3300009826 Bacteria 2651
42 Ga0123355_10338174 3300009826 Bacteria 2009
43 Ga0123355_10435245 3300009826 Bacteria 1665
44 2227136357 2225789004 Bacteria 36673
45 JGI24705J35276_12227876 3300002504 Bacteria 3080
46 Ga0072941_1277827 3300005201 Bacteria 6176
47 Ga0466700_280014 3300042600 Bacteria 5519
48 Ga0466721_251692 3300042608 Unclassified 1749
49 Ga0466693_097377 3300042592 Bacteria 2404
50 Ga0466696_058047 3300042596 Bacteria 1368
51 Ga0466696_100511 3300042596 Bacteria 1598
52 Ga0466711_381786 3300042615 Bacteria 2138
53 Ga0466715_521505 3300042616 Bacteria 2423
54 Ga0466703_181732 3300042636 Bacteria 3345
55 Ga0466724_18707 3300042649 Bacteria 1986
56 Ga0466733_107419 3300042659 Bacteria 14060
57 Ga0562375_0163 3300056856 Bacteria 195962
58 Ga0123355_10000432 3300009826 Bacteria 55030
59 Ga0123355_10001503 3300009826 Bacteria 32515
60 Ga0123355_10052165 3300009826 Bacteria 6637
61 Ga0123355_10097000 3300009826 Bacteria 4654
62 Ga0123355_10300361 3300009826 Bacteria 2190
63 Ga0123355_10413874 3300009826 Bacteria 1729
64 Ga0123356_10206488 3300010049 Bacteria 2009
65 Ga0123356_10484454 3300010049 Bacteria 1390
66 Ga0123353_10072521 3300010167 Bacteria 5533
67 Ga0123353_10508620 3300010167 Bacteria 1752
68 JGI24702J35022_10036910 3300002462 Bacteria 2611
69 Ga0466700_142382 3300042600 Bacteria 2632
70 Ga0466700_176978 3300042600 Bacteria 10369
71 Ga0466693_325535 3300042592 Bacteria 2423
72 Ga0466715_091182 3300042616 Bacteria 1548
73 Ga0466705_063534 3300042612 Bacteria 1800
74 Ga0466705_323142 3300042612 Bacteria 2905
75 Ga0123355_10000209 3300009826 Bacteria 73367
76 Ga0123355_10000344 3300009826 Bacteria 60129
77 Ga0123355_10001114 3300009826 Bacteria 37193
78 Ga0123355_10001658 3300009826 Bacteria 30972
79 Ga0123355_10013604 3300009826 Bacteria 12674
80 Ga0123355_10049858 3300009826 Bacteria 6805
81 Ga0123355_10074452 3300009826 Bacteria 5440
82 Ga0123355_10076451 3300009826 Bacteria 5355
83 Ga0123355_10129944 3300009826 Bacteria 3883
84 Ga0123355_10305076 3300009826 Bacteria 2165
85 Ga0123355_10329957 3300009826 Bacteria 2045
86 Ga0123355_10449632 3300009826 Bacteria 1625
87 Ga0123355_10506238 3300009826 Bacteria 1486
88 Ga0466693_017748 3300042592 Bacteria 4542
89 Ga0466694_148335 3300042594 Unclassified 4775
90 Ga0466728_266200 3300042620 Bacteria 2604
91 Ga0466729_046926 3300042621 Bacteria 9243
92 Ga0123355_10001058 3300009826 Bacteria 38099
93 Ga0123355_10002354 3300009826 Bacteria 26697
94 Ga0123355_10031179 3300009826 Bacteria 8648
95 Ga0123355_10051355 3300009826 Bacteria 6692
96 Ga0123355_10193211 3300009826 Unclassified 2992
97 Ga0123355_10226590 3300009826 Bacteria 2677
98 Ga0123355_10241653 3300009826 Bacteria 2557
99 Ga0123355_10637786 3300009826 Bacteria 1249
100 IMNBL1DRAFT_c0025692 3300000062 Bacteria 2253
101 JGI24705J35276_12228002 3300002504 Bacteria 3106
102 Ga0466700_250414 3300042600 Bacteria 6307
103 Ga0466700_406025 3300042600 Bacteria 18685
104 Ga0466725_210025 3300042654 Bacteria 1790

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF08279 HTH_11 HTH domain 47 98 0.93
PF08220 HTH_DeoR DeoR-like helix-turn-helix domain 47 91 0.89
PF13280 WYL WYL domain 173 336 0.88
PF19187 HTH_PafC PafC helix-turn-helix domain 44 94 0.82

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.