Protein Family IF02463

Metagenome Isolate
124 Members
49 Samples
103 Scaffolds
179.39 Avg Length

🧬 Representative Sequence

ID
3300009826|Ga0123355_10142919|Ga0123355_101429192
Length
209 aa
Sequence
MQIALTFLTRYTPMGLLVLLYMLYLEQPIINRREGLVMNLHTPLSTEDVSKLKAGDTITITGAIYTARDAAHLRMYEAYKNGEAPPFDYTGQAVFYAGPCPAPPGKPIGSVGPTTAGRMDAYSPALIEAGLKIMIGKGARAPKVVEAIKQHGGLYVVAIGGTAALMAKCVKSSEVVAYNDLGTEAVRKLMVVDMPLVVAIDSTGGSIF*

📊 Sample Types

Isolate 16.9%
Metagenome 83.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 43.8%
Termitidae 29.2%
Kalotermitidae 16.7%
Rhinotermitidae 6.2%
Termopsidae 4.2%

🌳 Taxonomy

Archaea 0
Bacteria 121
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820288918 Unclassified Firmicutes Th196P3bin137 Isolate Unclassified
2 2820294436 Unclassified Firmicutes Th196P3bin104 Isolate Unclassified
3 2820303403 Unclassified Firmicutes Th196P1bin2 Isolate Unclassified
4 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
5 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
6 2781125691 Treponema sp. Th196P3bin73 Isolate Unclassified
7 2820246658 Unclassified Firmicutes Th196P3bin70 Isolate Unclassified
8 2820336130 Unclassified Firmicutes Nt197P3bin70 Isolate Unclassified
9 2820637417 Unclassified Firmicutes Emb289P1bin108 Isolate Unclassified
10 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
11 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
12 2820171952 Unclassified Planctomycetes Th196P3bin88 Isolate Unclassified
13 2820705605 Unclassified Firmicutes Co191P1bin34 Isolate Unclassified
14 2820713307 Unclassified Firmicutes Co191P1bin2 Isolate Unclassified
15 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
16 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
17 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
18 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
19 2820244222 Unclassified Firmicutes Th196P3bin75 Isolate Unclassified
20 2820292184 Unclassified Firmicutes Th196P3bin109 Isolate Unclassified
21 2820296961 Unclassified Firmicutes Th196P3bin102 Isolate Unclassified
22 2820600392 Unclassified Firmicutes Emb289P1bin52 Isolate Unclassified
23 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
24 2820242869 Unclassified Firmicutes Th196P3bin82 Isolate Unclassified
25 2820623020 Unclassified Firmicutes Emb289P1bin126 Isolate Unclassified
26 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
27 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
28 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
29 2820408893 Unclassified Firmicutes Lab288P4bin80 Isolate Unclassified
30 2820472365 Unclassified Firmicutes Lab288P1bin87 Isolate Unclassified
31 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
32 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
33 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
34 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
35 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
36 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
37 2820620956 Unclassified Firmicutes Emb289P1bin128 Isolate Unclassified
38 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
39 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
40 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
41 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
42 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
43 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
44 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
45 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
46 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
47 2820277137 Unclassified Firmicutes Th196P3bin150 Isolate Unclassified
48 2820282995 Unclassified Firmicutes Th196P3bin147 Isolate Unclassified
49 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466712_144149 3300042614 Bacteria 2219
2 Ga0123357_10055439 3300009784 Bacteria 5336
3 Ga0123357_10216089 3300009784 Bacteria 2140
4 Ga0123357_10350046 3300009784 Bacteria 1415
5 Ga0123355_10000202 3300009826 Bacteria 74240
6 Ga0123355_10001041 3300009826 Bacteria 38402
7 Ga0123355_10023288 3300009826 Bacteria 9946
8 Ga0123355_10074651 3300009826 Bacteria 5432
9 Ga0123355_10150679 3300009826 Bacteria 3534
10 Ga0123355_10539302 3300009826 Bacteria 1417
11 Ga0123356_11153532 3300010049 Bacteria 942
12 Ga0123353_10093680 3300010167 Bacteria 4840
13 Ga0123353_10198204 3300010167 Bacteria 3162
14 JGI24702J35022_10253849 3300002462 Bacteria 1024
15 Ga0466690_232176 3300042590 Bacteria 13052
16 Ga0466693_100724 3300042592 Bacteria 2722
17 Ga0466696_109836 3300042596 Bacteria 40581
18 Ga0466696_281278 3300042596 Bacteria 4297
19 Ga0466699_048093 3300042597 Bacteria 3176
20 Ga0466715_105462 3300042616 Bacteria 2686
21 Ga0466723_267137 3300042618 Bacteria 14247
22 Ga0123355_10001465 3300009826 Bacteria 32851
23 Ga0123355_10002467 3300009826 Bacteria 26167
24 Ga0123355_10063828 3300009826 Bacteria 5937
25 Ga0123355_10336868 3300009826 Bacteria 2014
26 Ga0123355_10601060 3300009826 Unclassified 1305
27 Ga0123355_10602888 3300009826 Bacteria 1302
28 Ga0123355_10637067 3300009826 Unclassified 1250
29 Ga0123353_10692125 3300010167 Bacteria 1433
30 Ga0123354_10254134 3300010882 Bacteria 1772
31 Ga0466722_107970 3300042609 Bacteria 6292
32 Ga0466726_133712 3300042619 Unclassified 2231
33 Ga0123355_10000082 3300009826 Bacteria 100593
34 Ga0123355_10003365 3300009826 Bacteria 22898
35 Ga0123355_10021468 3300009826 Bacteria 10334
36 Ga0123355_10080707 3300009826 Bacteria 5192
37 Ga0123355_10097038 3300009826 Bacteria 4652
38 Ga0123355_10830970 3300009826 Bacteria 1022
39 Ga0466717_015172 3300042604 Bacteria 10819
40 JGI24703J35330_11699611 3300002501 Bacteria 2009
41 Ga0123355_10000234 3300009826 Bacteria 70892
42 Ga0123355_10005257 3300009826 Bacteria 18906
43 Ga0123355_10007969 3300009826 Bacteria 15963
44 Ga0123355_10142919 3300009826 Bacteria 3656
45 Ga0123355_10515993 3300009826 Bacteria 1465
46 Ga0123356_10059123 3300010049 Bacteria 3575
47 Ga0123356_10098660 3300010049 Bacteria 2798
48 Ga0123356_11121916 3300010049 Bacteria 954
49 Ga0123353_10666812 3300010167 Bacteria 1468
50 Ga0466719_535056 3300042606 Bacteria 5962
51 JGI24700J35501_10923980 3300002508 Bacteria 5331
52 Ga0072941_1170984 3300005201 Bacteria 1634
53 Ga0466699_369951 3300042597 Bacteria 2109
54 Ga0466704_130547 3300042643 Bacteria 19196
55 Ga0123355_10000315 3300009826 Bacteria 62307
56 Ga0123355_10001688 3300009826 Bacteria 30693
57 Ga0123355_10043595 3300009826 Bacteria 7299
58 Ga0123355_10060716 3300009826 Bacteria 6104
59 Ga0123355_10231478 3300009826 Bacteria 2638
60 Ga0123355_10236191 3300009826 Bacteria 2600
61 Ga0123353_10720385 3300010167 Bacteria 1396
62 Ga0466700_034334 3300042600 Bacteria 2146
63 Ga0466714_040662 3300042603 Bacteria 4385
64 Ga0466692_151484 3300042591 Bacteria 11757
65 Ga0466705_493300 3300042612 Bacteria 21538
66 Ga0466726_064665 3300042619 Bacteria 16208
67 Ga0123355_10004700 3300009826 Bacteria 19859
68 Ga0123355_10237034 3300009826 Bacteria 2593
69 Ga0123355_10893611 3300009826 Bacteria 967
70 Ga0123355_11359245 3300009826 Bacteria 706
71 Ga0123356_11526584 3300010049 Bacteria 825
72 Ga0123353_10325104 3300010167 Bacteria 2332
73 Ga0123353_11332638 3300010167 Bacteria 929
74 Ga0466722_186589 3300042609 Bacteria 2836
75 Ga0466690_208882 3300042590 Bacteria 1334
76 Ga0466705_219188 3300042612 Bacteria 24499
77 Ga0466705_291391 3300042612 Bacteria 2063
78 Ga0466715_029946 3300042616 Bacteria 45596
79 Ga0123355_10003333 3300009826 Bacteria 22976
80 Ga0123355_10081660 3300009826 Bacteria 5158
81 Ga0123355_10143028 3300009826 Bacteria 3654
82 Ga0123355_10222959 3300009826 Bacteria 2708
83 Ga0123355_10407644 3300009826 Bacteria 1748
84 Ga0123354_10076280 3300010882 Bacteria 4786
85 Ga0466700_418447 3300042600 Bacteria 1464
86 Ga0466717_064213 3300042604 Bacteria 1384
87 Ga0466699_389633 3300042597 Bacteria 11366
88 Ga0466704_240234 3300042643 Bacteria 65177
89 Ga0466727_239402 3300042655 Bacteria 3048
90 Ga0466705_008628 3300042612 Bacteria 2473
91 Ga0466705_078954 3300042612 Bacteria 3380
92 Ga0123355_10392972 3300009826 Bacteria 1796
93 Ga0123355_10474541 3300009826 Bacteria 1560
94 Ga0123356_10253798 3300010049 Bacteria 1838
95 Ga0123353_10328334 3300010167 Bacteria 2317
96 Ga0123353_10951029 3300010167 Bacteria 1162
97 Ga0466714_007733 3300042603 Bacteria 2153
98 Ga0466719_055778 3300042606 Bacteria 11497
99 Ga0466722_175030 3300042609 Bacteria 11141
100 Ga0466722_251482 3300042609 Bacteria 1215
101 Ga0456237_0008483 3300041968 Bacteria 1549
102 Ga0466691_173950 3300042593 Bacteria 8043
103 Ga0466699_167190 3300042597 Bacteria 1319

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF05683 Fumerase_C Fumarase C-terminus 36 208 0.96

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF05683 GO:0016836 hydro-lyase activity MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.