Protein Family IF02437

Metagenome Isolate
153 Members
67 Samples
116 Scaffolds
182.24 Avg Length

🧬 Representative Sequence

ID
3300009826|Ga0123355_10091499|Ga0123355_100914994
Length
206 aa
Sequence
MKNTLLQIKIVHEITVSPHIGGIILKATGIVRRMDDLGRVVIPKEIRRTLRIREGDPLEIFTDREGEIILKKYSPIGELGAFAKEYAESLAQTAGHITCIIDKDQIVAVSGGAKKDFFEKHISAELECVINNRNTHMASRTDSSFVPILKDDAEGVYNHELITPIVSEGDVLGAVVFLSPDKQMGDLESKLAHTAAGFLGRQMEQ*

📊 Sample Types

Isolate 24.2%
Metagenome 75.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 50.7%
Termitidae 23.9%
Kalotermitidae 9.0%
Passalidae 4.5%
Termopsidae 3.0%
Rhinotermitidae 3.0%
Drosophilidae 1.5%
Scarabaeidae 1.5%
Formicidae 1.5%
Tenebrionidae 1.5%

🌳 Taxonomy

Archaea 0
Bacteria 135
Eukaryota 0
Viruses 0
Unclassified 18

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820539610 Unclassified Firmicutes Lab288P1bin136 Isolate Unclassified
2 2820676843 Unclassified Firmicutes Co191P3bin17 Isolate Unclassified
3 2820713307 Unclassified Firmicutes Co191P1bin2 Isolate Unclassified
4 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
5 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
6 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
7 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
8 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
9 2852123468 Lysinibacillus sphaericus KCCM 35418 Isolate Unclassified
10 2590828839 Clostridium sp. 1 Isolate Termitidae
11 2820698910 Unclassified Firmicutes Co191P1bin64 Isolate Unclassified
12 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
13 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
14 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
15 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
16 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
17 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
18 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
19 2820329821 Unclassified Firmicutes Nt197P3bin77 Isolate Unclassified
20 2820627938 Unclassified Firmicutes Emb289P1bin122 Isolate Unclassified
21 2820693137 Unclassified Firmicutes Co191P1bin70 Isolate Unclassified
22 2820615445 Unclassified Firmicutes Emb289P1bin132 Isolate Unclassified
23 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
24 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
25 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
26 2855361764 Lysinibacillus fusiformis Juneja Isolate Drosophilidae
27 2590828840 Clostridium sp. 2 Isolate Termitidae
28 2634166424 Clostridium sp. L74 Isolate Scarabaeidae
29 2820467504 Unclassified Firmicutes Lab288P3bin1 Isolate Unclassified
30 2820481688 Unclassified Firmicutes Lab288P1bin76 Isolate Unclassified
31 2820490862 Unclassified Firmicutes Lab288P1bin64 Isolate Unclassified
32 2820537337 Unclassified Firmicutes Lab288P1bin137 Isolate Unclassified
33 2820623020 Unclassified Firmicutes Emb289P1bin126 Isolate Unclassified
34 2820633305 Unclassified Firmicutes Emb289P1bin118 Isolate Unclassified
35 2820696217 Unclassified Firmicutes Co191P1bin66 Isolate Unclassified
36 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
37 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
38 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
39 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
40 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
41 2890957088 Psychrobacillus lasiicapitis NEAU-3TGS17 Isolate Formicidae
42 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
43 2524614537 Lysinibacillus sphaericus OT4b.31 Isolate Unclassified
44 2751185832 Lysinibacillus sp. AR18-8 Isolate Unclassified
45 2820525019 Unclassified Firmicutes Lab288P1bin2 Isolate Unclassified
46 2820592308 Unclassified Firmicutes Emb289P1bin71 Isolate Unclassified
47 2820630457 Unclassified Firmicutes Emb289P1bin119 Isolate Unclassified
48 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
49 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
50 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
51 2843246524 Lysinibacillus sphaericus DSM 28 Isolate Unclassified
52 2820499546 Unclassified Firmicutes Lab288P1bin54 Isolate Unclassified
53 2820522177 Unclassified Firmicutes Lab288P1bin22 Isolate Unclassified
54 2820644600 Unclassified Firmicutes Cu122P5bin39 Isolate Unclassified
55 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
56 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
57 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
58 2593339125 Clostridium sp. 5 Isolate Termitidae
59 2820432912 Unclassified Firmicutes Lab288P3bin219 Isolate Unclassified
60 2820501819 Unclassified Firmicutes Lab288P1bin51 Isolate Unclassified
61 2820530790 Unclassified Firmicutes Lab288P1bin141 Isolate Unclassified
62 2820598593 Unclassified Firmicutes Emb289P1bin53 Isolate Unclassified
63 2820607737 Unclassified Firmicutes Emb289P1bin48 Isolate Unclassified
64 2820663833 Unclassified Firmicutes Co191P3bin41 Isolate Unclassified
65 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
66 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
67 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123355_10000177 3300009826 Bacteria 78715
2 Ga0123355_10035325 3300009826 Bacteria 8124
3 Ga0123355_10073061 3300009826 Unclassified 5499
4 Ga0123355_10164188 3300009826 Unclassified 3337
5 Ga0123355_10666472 3300009826 Bacteria 1208
6 Ga0123355_10671490 3300009826 Unclassified 1201
7 Ga0123355_10676106 3300009826 Bacteria 1195
8 Ga0123353_10515531 3300010167 Bacteria 1737
9 Ga0123353_11178060 3300010167 Bacteria 1008
10 Ga0466696_100863 3300042596 Bacteria 4358
11 Ga0466713_061403 3300042602 Bacteria 5875
12 Ga0466714_166603 3300042603 Unclassified 5351
13 IMNBL1DRAFT_c0000455 3300000062 Bacteria 34238
14 JGI24695J34938_10000056 3300002450 Bacteria 90027
15 Ga0466705_184477 3300042612 Bacteria 12712
16 Ga0466733_021423 3300042659 Bacteria 1549
17 Ga0466733_088893 3300042659 Bacteria 18266
18 Ga0123355_10000001 3300009826 Bacteria 286680
19 Ga0123355_10018255 3300009826 Bacteria 11116
20 Ga0123355_10157117 3300009826 Bacteria 3437
21 Ga0123356_10408391 3300010049 Unclassified 1497
22 Ga0466729_154660 3300042621 Bacteria 19850
23 Ga0466729_258140 3300042621 Bacteria 75126
24 Ga0415639_000031 3300038395 Bacteria 36714
25 Ga0466714_033412 3300042603 Bacteria 1861
26 Ga0466714_086992 3300042603 Bacteria 5750
27 IMNBL1DRAFT_c0006517 3300000062 Bacteria 6361
28 JGI24695J34938_10000630 3300002450 Unclassified 33602
29 Ga0123355_10002112 3300009826 Bacteria 28041
30 Ga0123355_10125781 3300009826 Bacteria 3962
31 Ga0123355_10137049 3300009826 Bacteria 3756
32 Ga0123355_10152769 3300009826 Bacteria 3501
33 Ga0123355_10305622 3300009826 Bacteria 2162
34 Ga0123355_10750323 3300009826 Unclassified 1104
35 Ga0123355_11394967 3300009826 Bacteria 693
36 Ga0123353_10543587 3300010167 Bacteria 1678
37 Ga0123353_11035326 3300010167 Bacteria 1098
38 Ga0466725_277463 3300042654 Unclassified 1355
39 Ga0466725_331812 3300042654 Unclassified 9295
40 Ga0466693_162034 3300042592 Bacteria 9294
41 Ga0466707_131389 3300042601 Bacteria 97048
42 Ga0466714_118778 3300042603 Bacteria 2032
43 2227063696 2225789003 Bacteria 16908
44 JGI24703J35330_11655865 3300002501 Bacteria 1626
45 Ga0466733_184980 3300042659 Unclassified 3115
46 Ga0562377_0006 3300056842 Bacteria 3350072
47 Ga0123355_10002873 3300009826 Bacteria 24458
48 Ga0123355_10015490 3300009826 Bacteria 11984
49 Ga0123355_10383485 3300009826 Bacteria 1829
50 Ga0123355_10420198 3300009826 Bacteria 1709
51 Ga0123355_11078389 3300009826 Bacteria 839
52 Ga0123356_10206339 3300010049 Bacteria 2009
53 Ga0123356_10355550 3300010049 Bacteria 1590
54 Ga0123353_10170249 3300010167 Bacteria 3458
55 Ga0466704_527446 3300042643 Bacteria 3648
56 Ga0466693_137397 3300042592 Bacteria 5012
57 Ga0466696_334307 3300042596 Bacteria 1012
58 Ga0466701_044574 3300042598 Bacteria 1338
59 IMNBL1DRAFT_c0002162 3300000062 Bacteria 13919
60 Ga0466705_171671 3300042612 Bacteria 30504
61 Ga0123355_10000954 3300009826 Bacteria 40026
62 Ga0123355_10004823 3300009826 Bacteria 19633
63 Ga0123355_10089353 3300009826 Bacteria 4890
64 Ga0123355_10417821 3300009826 Bacteria 1716
65 Ga0123355_10978958 3300009826 Unclassified 902
66 Ga0123356_11336157 3300010049 Bacteria 879
67 Ga0466715_113842 3300042616 Bacteria 1503
68 Ga0466725_038033 3300042654 Unclassified 7474
69 Ga0415639_043804 3300038395 Bacteria 7364
70 Ga0466693_212244 3300042592 Bacteria 1312
71 Ga0466722_105733 3300042609 Bacteria 9022
72 IMNBL1DRAFT_c0002257 3300000062 Bacteria 13566
73 Ga0123355_10049865 3300009826 Bacteria 6805
74 Ga0123355_10055177 3300009826 Bacteria 6434
75 Ga0123355_10306285 3300009826 Bacteria 2159
76 Ga0123355_10557056 3300009826 Bacteria 1383
77 Ga0123355_10574193 3300009826 Bacteria 1351
78 Ga0123353_10272378 3300010167 Unclassified 2607
79 Ga0466715_458732 3300042616 Bacteria 26908
80 Ga0466693_258580 3300042592 Bacteria 1298
81 Ga0466696_106388 3300042596 Bacteria 1710
82 JGI24703J35330_11694180 3300002501 Bacteria 1942
83 Ga0068305_10322948 3300005083 Bacteria 5990
84 Ga0123355_10020258 3300009826 Unclassified 10615
85 Ga0123355_10091037 3300009826 Unclassified 4836
86 Ga0123355_10120067 3300009826 Bacteria 4081
87 Ga0123355_10405841 3300009826 Bacteria 1753
88 Ga0123355_10931875 3300009826 Bacteria 937
89 Ga0123353_10492564 3300010167 Bacteria 1789
90 Ga0123353_11725341 3300010167 Bacteria 783
91 Ga0466726_174374 3300042619 Bacteria 1740
92 Ga0466724_38471 3300042649 Bacteria 2685
93 Ga0466693_198899 3300042592 Bacteria 1237
94 Ga0466693_350500 3300042592 Bacteria 6715
95 Ga0466713_151579 3300042602 Bacteria 7706
96 Ga0466714_013778 3300042603 Bacteria 1123
97 Ga0466714_024490 3300042603 Bacteria 21789
98 Ga0466719_232261 3300042606 Bacteria 1400
99 Ga0466733_124137 3300042659 Bacteria 4338
100 Ga0123355_10057012 3300009826 Bacteria 6323
101 Ga0123355_10073328 3300009826 Bacteria 5487
102 Ga0123355_10091499 3300009826 Bacteria 4822
103 Ga0123355_10498755 3300009826 Bacteria 1503
104 Ga0123353_11860689 3300010167 Unclassified 745
105 Ga0123354_10179784 3300010882 Bacteria 2421
106 Ga0466735_079241 3300042624 Bacteria 1273
107 Ga0466703_124542 3300042636 Bacteria 1917
108 Ga0466693_292544 3300042592 Bacteria 1717
109 Ga0466693_342059 3300042592 Bacteria 1012
110 Ga0466714_066670 3300042603 Bacteria 5183
111 Ga0466714_099375 3300042603 Bacteria 1030
112 Ga0466714_106424 3300042603 Unclassified 1050
113 Ga0466714_159108 3300042603 Bacteria 1086
114 Ga0466722_003293 3300042609 Bacteria 3661
115 2227192771 2225789004 Unclassified 1460
116 IMNBL1DRAFT_c0000009 3300000062 Bacteria 243341

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF15714 SpoVT_C Stage V sporulation protein T C-terminal, transcription factor 78 204 0.96
PF04014 MazE_antitoxin Antidote-toxin recognition MazE, bacterial antitoxin 33 75 0.91

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF04014 GO:0003677 DNA binding MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.