Protein Family IF02432
Metagenome
Isolate
170
Members
45
Samples
163
Scaffolds
309.65
Avg Length
Representative Sequence
- ID
- 3300009826|Ga0123355_10081029|Ga0123355_100810292
- Length
- 354 aa
- Sequence
- MTPVFYCFNAKITNCNKACLSNIINSLILIMGVVATMVNETQKNLTAKAIKNKNGFGNYFRDNWDLYVMLAPAVVFILIFAYWPMYGVLMAFQNYNPFQGIMGSPWVGLAHFKRFFGTPTAMRIIINTIMLSVQTLIFTFPAPIFLAIMLHYCISRRFSKIVQTATYFPFFIATVVLVGMMHLFFSPSVGLVNHAIEAFGGQRIVFMADSAWFRPLYVGSRIWQGTGFAAIIYIAALAGVDPTLYEAASIDGASKWNRIRHIDIPTIAPTIIIMLILALGQIMNVGFEQVFLMQNPRNTEVSDIIATYVYRMGLLEGRFSFATAVGLFNSVVNFILLITVNWAARKASSTSLW*
Sample Types
Isolate
4.1%
Metagenome
95.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
35.7%
Kalotermitidae
31.0%
Unclassified
14.3%
Rhinotermitidae
7.1%
Termopsidae
7.1%
Armadillidiidae
2.4%
Passalidae
2.4%
Taxonomy
Archaea
0
Bacteria
164
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 2 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 3 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 4 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 5 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 6 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 7 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 8 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 9 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 10 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 11 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 12 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 13 | 2820332331 | Unclassified Firmicutes Nt197P3bin75 | Isolate | Unclassified |
| 14 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 15 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 16 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 17 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 18 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 19 | 2820298281 | Unclassified Firmicutes Th196P1bin9 | Isolate | Unclassified |
| 20 | 2820623020 | Unclassified Firmicutes Emb289P1bin126 | Isolate | Unclassified |
| 21 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 22 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 23 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 24 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 25 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 26 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 27 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 28 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 29 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 30 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 31 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 32 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 33 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 34 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 35 | 2820617402 | Unclassified Firmicutes Emb289P1bin131 | Isolate | Unclassified |
| 36 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 37 | 2576861701 | Paenibacillus sp. JCM 10914 | Isolate | Termitidae |
| 38 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 39 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 40 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 41 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 42 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 43 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 44 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 45 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_064910 | 3300042612 | Bacteria | 12911 |
| 2 | Ga0466696_114795 | 3300042596 | Bacteria | 8182 |
| 3 | Ga0466707_105392 | 3300042601 | Bacteria | 3769 |
| 4 | Ga0466707_349247 | 3300042601 | Bacteria | 1566 |
| 5 | Ga0466722_209416 | 3300042609 | Bacteria | 1719 |
| 6 | Ga0466711_090127 | 3300042615 | Unclassified | 10659 |
| 7 | Ga0466711_140679 | 3300042615 | Bacteria | 7418 |
| 8 | Ga0466715_341185 | 3300042616 | Bacteria | 2135 |
| 9 | Ga0123353_10385511 | 3300010167 | Bacteria | 2094 |
| 10 | Ga0123353_10434011 | 3300010167 | Bacteria | 1941 |
| 11 | Ga0123353_10850666 | 3300010167 | Bacteria | 1250 |
| 12 | Ga0466704_418529 | 3300042643 | Bacteria | 4625 |
| 13 | Ga0466704_480692 | 3300042643 | Bacteria | 4149 |
| 14 | Ga0466708_223026 | 3300042652 | Bacteria | 2597 |
| 15 | Ga0466705_215592 | 3300042612 | Bacteria | 4932 |
| 16 | Ga0466733_168377 | 3300042659 | Bacteria | 1392 |
| 17 | Ga0415639_026723 | 3300038395 | Bacteria | 7509 |
| 18 | Ga0466700_133300 | 3300042600 | Bacteria | 1666 |
| 19 | Ga0466722_171739 | 3300042609 | Bacteria | 11443 |
| 20 | Ga0466722_268109 | 3300042609 | Bacteria | 1737 |
| 21 | Ga0466715_145970 | 3300042616 | Bacteria | 8667 |
| 22 | Ga0123355_10001863 | 3300009826 | Bacteria | 29599 |
| 23 | Ga0123355_10081029 | 3300009826 | Bacteria | 5180 |
| 24 | Ga0123356_10156390 | 3300010049 | Bacteria | 2271 |
| 25 | Ga0466729_296341 | 3300042621 | Bacteria | 1373 |
| 26 | Ga0466703_174344 | 3300042636 | Bacteria | 5212 |
| 27 | Ga0466703_380155 | 3300042636 | Bacteria | 2032 |
| 28 | Ga0466704_089812 | 3300042643 | Bacteria | 9068 |
| 29 | Ga0466704_375873 | 3300042643 | Bacteria | 1757 |
| 30 | Ga0466727_132968 | 3300042655 | Bacteria | 1868 |
| 31 | Ga0466705_175745 | 3300042612 | Bacteria | 27252 |
| 32 | Ga0466705_200508 | 3300042612 | Bacteria | 16313 |
| 33 | Ga0160452_103092 | 3300012834 | Bacteria | 3095 |
| 34 | Ga0466691_010182 | 3300042593 | Bacteria | 10973 |
| 35 | Ga0466694_005819 | 3300042594 | Bacteria | 2134 |
| 36 | Ga0466696_067058 | 3300042596 | Bacteria | 9099 |
| 37 | Ga0466707_323348 | 3300042601 | Bacteria | 2124 |
| 38 | Ga0466719_093282 | 3300042606 | Bacteria | 16238 |
| 39 | Ga0466705_444223 | 3300042612 | Unclassified | 11615 |
| 40 | Ga0466711_075708 | 3300042615 | Bacteria | 8865 |
| 41 | Ga0123355_10000251 | 3300009826 | Bacteria | 69105 |
| 42 | Ga0123353_10173761 | 3300010167 | Bacteria | 3418 |
| 43 | Ga0123353_10704165 | 3300010167 | Bacteria | 1417 |
| 44 | Ga0123353_11024482 | 3300010167 | Bacteria | 1106 |
| 45 | Ga0466703_290790 | 3300042636 | Bacteria | 1553 |
| 46 | Ga0466704_393442 | 3300042643 | Bacteria | 4155 |
| 47 | Ga0466709_272942 | 3300042648 | Bacteria | 11712 |
| 48 | Ga0466709_306724 | 3300042648 | Bacteria | 13902 |
| 49 | Ga0466727_017501 | 3300042655 | Bacteria | 4282 |
| 50 | Ga0466727_145238 | 3300042655 | Bacteria | 5349 |
| 51 | 2227511609 | 2225789004 | Bacteria | 3541 |
| 52 | Ga0072940_1014844 | 3300005200 | Bacteria | 12189 |
| 53 | Ga0123357_10000078 | 3300009784 | Bacteria | 77439 |
| 54 | Ga0466705_381758 | 3300042612 | Bacteria | 4589 |
| 55 | Ga0466696_141536 | 3300042596 | Bacteria | 13963 |
| 56 | Ga0466701_018540 | 3300042598 | Bacteria | 235065 |
| 57 | Ga0466707_310263 | 3300042601 | Bacteria | 4068 |
| 58 | Ga0466719_130647 | 3300042606 | Bacteria | 1626 |
| 59 | Ga0466719_363661 | 3300042606 | Bacteria | 2224 |
| 60 | Ga0466719_404094 | 3300042606 | Bacteria | 18680 |
| 61 | Ga0466711_041791 | 3300042615 | Bacteria | 8325 |
| 62 | Ga0466711_059887 | 3300042615 | Bacteria | 1742 |
| 63 | Ga0466711_180267 | 3300042615 | Bacteria | 2125 |
| 64 | Ga0466715_017854 | 3300042616 | Bacteria | 5161 |
| 65 | Ga0466715_382365 | 3300042616 | Bacteria | 3847 |
| 66 | Ga0466728_155469 | 3300042620 | Bacteria | 3220 |
| 67 | Ga0123354_10069254 | 3300010882 | Bacteria | 5118 |
| 68 | Ga0466708_039903 | 3300042652 | Bacteria | 2404 |
| 69 | Ga0466708_137293 | 3300042652 | Bacteria | 3496 |
| 70 | Ga0466708_415485 | 3300042652 | Bacteria | 2352 |
| 71 | Ga0466705_044975 | 3300042612 | Bacteria | 16250 |
| 72 | Ga0466705_046428 | 3300042612 | Bacteria | 8056 |
| 73 | Ga0466705_085526 | 3300042612 | Unclassified | 1858 |
| 74 | Ga0466705_196679 | 3300042612 | Bacteria | 8883 |
| 75 | Ga0456237_0005779 | 3300041968 | Bacteria | 1955 |
| 76 | Ga0466690_258840 | 3300042590 | Bacteria | 2122 |
| 77 | Ga0466691_041567 | 3300042593 | Bacteria | 4940 |
| 78 | Ga0466694_119231 | 3300042594 | Bacteria | 6292 |
| 79 | Ga0466707_067870 | 3300042601 | Bacteria | 1549 |
| 80 | Ga0466707_078670 | 3300042601 | Bacteria | 2878 |
| 81 | Ga0466717_305374 | 3300042604 | Bacteria | 1611 |
| 82 | Ga0466719_007135 | 3300042606 | Unclassified | 7188 |
| 83 | Ga0466722_222645 | 3300042609 | Bacteria | 2752 |
| 84 | Ga0466711_098063 | 3300042615 | Bacteria | 2246 |
| 85 | Ga0466715_017335 | 3300042616 | Bacteria | 14322 |
| 86 | Ga0466715_528793 | 3300042616 | Bacteria | 6069 |
| 87 | Ga0466723_104915 | 3300042618 | Bacteria | 6460 |
| 88 | Ga0123355_10003382 | 3300009826 | Bacteria | 22839 |
| 89 | Ga0123355_10209564 | 3300009826 | Bacteria | 2828 |
| 90 | Ga0123355_10353138 | 3300009826 | Bacteria | 1945 |
| 91 | Ga0123353_10183008 | 3300010167 | Bacteria | 3315 |
| 92 | Ga0466729_203538 | 3300042621 | Bacteria | 1080 |
| 93 | Ga0466703_267100 | 3300042636 | Bacteria | 3173 |
| 94 | Ga0466704_262053 | 3300042643 | Bacteria | 2623 |
| 95 | Ga0466708_460597 | 3300042652 | Bacteria | 3049 |
| 96 | Ga0466705_134328 | 3300042612 | Bacteria | 4045 |
| 97 | Ga0466705_299630 | 3300042612 | Bacteria | 1894 |
| 98 | Ga0466691_134119 | 3300042593 | Bacteria | 2007 |
| 99 | Ga0466696_139806 | 3300042596 | Bacteria | 12379 |
| 100 | Ga0466696_317024 | 3300042596 | Bacteria | 4821 |
| 101 | Ga0466719_562417 | 3300042606 | Bacteria | 5722 |
| 102 | Ga0466711_093783 | 3300042615 | Bacteria | 3040 |
| 103 | Ga0466711_241897 | 3300042615 | Bacteria | 4997 |
| 104 | Ga0466715_356094 | 3300042616 | Bacteria | 3410 |
| 105 | Ga0466715_616191 | 3300042616 | Bacteria | 12124 |
| 106 | Ga0466723_084434 | 3300042618 | Bacteria | 1477 |
| 107 | Ga0466723_366370 | 3300042618 | Bacteria | 3417 |
| 108 | Ga0466728_022346 | 3300042620 | Bacteria | 12381 |
| 109 | Ga0123355_10066680 | 3300009826 | Bacteria | 5793 |
| 110 | Ga0123355_10273932 | 3300009826 | Bacteria | 2340 |
| 111 | Ga0123355_10391738 | 3300009826 | Bacteria | 1800 |
| 112 | Ga0123355_10538186 | 3300009826 | Bacteria | 1419 |
| 113 | Ga0123353_10151040 | 3300010167 | Bacteria | 3709 |
| 114 | Ga0123353_10159342 | 3300010167 | Bacteria | 3594 |
| 115 | Ga0160464_100743 | 3300012805 | Bacteria | 18541 |
| 116 | Ga0466703_087352 | 3300042636 | Bacteria | 2086 |
| 117 | Ga0466704_066614 | 3300042643 | Bacteria | 9926 |
| 118 | Ga0466704_133879 | 3300042643 | Bacteria | 16498 |
| 119 | Ga0466704_509584 | 3300042643 | Bacteria | 1316 |
| 120 | Ga0466705_059535 | 3300042612 | Bacteria | 10173 |
| 121 | Ga0160445_102535 | 3300012847 | Bacteria | 4142 |
| 122 | Ga0466690_254640 | 3300042590 | Unclassified | 1020 |
| 123 | Ga0466719_461966 | 3300042606 | Bacteria | 3396 |
| 124 | Ga0466715_226389 | 3300042616 | Bacteria | 29197 |
| 125 | Ga0466723_180567 | 3300042618 | Bacteria | 3162 |
| 126 | Ga0466726_368125 | 3300042619 | Bacteria | 1723 |
| 127 | Ga0466728_210247 | 3300042620 | Bacteria | 4165 |
| 128 | Ga0123355_10104503 | 3300009826 | Bacteria | 4448 |
| 129 | Ga0123353_10037652 | 3300010167 | Bacteria | 7589 |
| 130 | Ga0466703_007438 | 3300042636 | Bacteria | 3894 |
| 131 | Ga0466703_375581 | 3300042636 | Bacteria | 1393 |
| 132 | Ga0466709_182473 | 3300042648 | Bacteria | 1401 |
| 133 | Ga0466708_024517 | 3300042652 | Bacteria | 10241 |
| 134 | Ga0072941_1159951 | 3300005201 | Bacteria | 2838 |
| 135 | Ga0123357_10001515 | 3300009784 | Bacteria | 24710 |
| 136 | Ga0466705_194333 | 3300042612 | Bacteria | 12390 |
| 137 | Ga0160445_104025 | 3300012847 | Bacteria | 2775 |
| 138 | Ga0415639_117595 | 3300038395 | Bacteria | 2713 |
| 139 | Ga0466690_172466 | 3300042590 | Bacteria | 3985 |
| 140 | Ga0466691_069525 | 3300042593 | Bacteria | 1634 |
| 141 | Ga0466696_102585 | 3300042596 | Bacteria | 5197 |
| 142 | Ga0466696_162810 | 3300042596 | Bacteria | 15634 |
| 143 | Ga0466696_383113 | 3300042596 | Unclassified | 1811 |
| 144 | Ga0466707_068303 | 3300042601 | Bacteria | 1408 |
| 145 | Ga0466714_065835 | 3300042603 | Bacteria | 1716 |
| 146 | Ga0466722_022975 | 3300042609 | Bacteria | 1794 |
| 147 | Ga0466715_146655 | 3300042616 | Bacteria | 1341 |
| 148 | Ga0466715_245443 | 3300042616 | Bacteria | 8497 |
| 149 | Ga0466715_414824 | 3300042616 | Bacteria | 1446 |
| 150 | Ga0466715_427337 | 3300042616 | Bacteria | 3973 |
| 151 | Ga0466715_434593 | 3300042616 | Bacteria | 23758 |
| 152 | Ga0466726_421174 | 3300042619 | Bacteria | 1097 |
| 153 | Ga0466728_114952 | 3300042620 | Bacteria | 1681 |
| 154 | Ga0466728_347397 | 3300042620 | Bacteria | 2207 |
| 155 | Ga0466728_384482 | 3300042620 | Bacteria | 1656 |
| 156 | Ga0123353_10610613 | 3300010167 | Bacteria | 1556 |
| 157 | Ga0466729_199041 | 3300042621 | Bacteria | 1209 |
| 158 | Ga0466729_307579 | 3300042621 | Bacteria | 5086 |
| 159 | Ga0466735_194250 | 3300042624 | Bacteria | 1946 |
| 160 | Ga0466704_180120 | 3300042643 | Bacteria | 8091 |
| 161 | Ga0466708_456404 | 3300042652 | Bacteria | 6613 |
| 162 | Ga0466727_340973 | 3300042655 | Bacteria | 3509 |
| 163 | JGI24700J35501_10928580 | 3300002508 | Bacteria | 7823 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00528 | BPD_transp_1 | Binding-protein-dependent transport system inner membrane component | 145 | 346 | 0.9 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.