Protein Family IF02428
Metagenome
Isolate
184
Members
51
Samples
170
Scaffolds
220.86
Avg Length
Representative Sequence
- ID
- 3300009826|Ga0123355_10073833|Ga0123355_100738334
- Length
- 250 aa
- Sequence
- LLHQRRSNSANAAKLFFKKIGGFALIVAEQKTIEEIAESIEGFSRLVIASCGTCVTVCMAGGEKEALKLQGLLLADADSKNKKLEIKVVNLKRQCDHEFIDDLIDELRDGDVILSLACGVGVQFMSEKFADKLIIPGLNTKFYGAAKALGYWTEYCQGCGNCLLERTCGICPVTRCSKSNFNGPCGGSQRGKCEIDPDNIDCAWQLIYDRVKSFDKLERLAGIFELRDWRTSRDGGPRSVRRSDVIVEE*
Sample Types
Isolate
7.6%
Metagenome
92.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
43.1%
Unclassified
31.4%
Kalotermitidae
25.5%
Taxonomy
Archaea
3
Bacteria
159
Eukaryota
0
Viruses
0
Unclassified
22
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820238527 | Unclassified Firmicutes Th196P3bin90 | Isolate | Unclassified |
| 2 | 2820442516 | Unclassified Firmicutes Lab288P3bin200 | Isolate | Unclassified |
| 3 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 7 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 8 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 9 | 2820590132 | Unclassified Firmicutes Emb289P1bin84 | Isolate | Unclassified |
| 10 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 11 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 12 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 13 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 14 | 2820234266 | Unclassified Firmicutes Th196P3bin99 | Isolate | Unclassified |
| 15 | 2820324456 | Unclassified Firmicutes Nt197P3bin80 | Isolate | Unclassified |
| 16 | 2820412446 | Unclassified Firmicutes Lab288P4bin39 | Isolate | Unclassified |
| 17 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 18 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 19 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 20 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 21 | 2820227065 | Unclassified Firmicutes Th196P4bin44 | Isolate | Unclassified |
| 22 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 23 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 24 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 25 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 26 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 27 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 28 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 29 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 30 | 2820314258 | Unclassified Firmicutes Nt197P4bin16 | Isolate | Unclassified |
| 31 | 2820357977 | Unclassified Firmicutes Nt197P3bin136 | Isolate | Unclassified |
| 32 | 2820483401 | Unclassified Firmicutes Lab288P1bin74 | Isolate | Unclassified |
| 33 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 34 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 35 | 2820223845 | Unclassified Firmicutes Th196P4bin57 | Isolate | Unclassified |
| 36 | 2820566695 | Unclassified Firmicutes Emb289P3bin50 | Isolate | Unclassified |
| 37 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 38 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 39 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 40 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 41 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 42 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 43 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 44 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 45 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 46 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 47 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 48 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 49 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 50 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 51 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_108375 | 3300042612 | Bacteria | 19945 |
| 2 | Ga0466725_101774 | 3300042654 | Bacteria | 1659 |
| 3 | Ga0466725_361665 | 3300042654 | Bacteria | 1297 |
| 4 | Ga0466723_368483 | 3300042618 | Bacteria | 1726 |
| 5 | Ga0123355_10067785 | 3300009826 | Bacteria | 5742 |
| 6 | Ga0123356_10040823 | 3300010049 | Archaea | 4322 |
| 7 | Ga0123356_10057576 | 3300010049 | Bacteria | 3623 |
| 8 | Ga0123356_10084599 | 3300010049 | Bacteria | 3007 |
| 9 | Ga0123356_10417816 | 3300010049 | Bacteria | 1482 |
| 10 | Ga0123356_10452729 | 3300010049 | Bacteria | 1432 |
| 11 | Ga0123353_10249416 | 3300010167 | Bacteria | 2751 |
| 12 | Ga0123353_10934444 | 3300010167 | Bacteria | 1175 |
| 13 | Ga0123353_11105072 | 3300010167 | Unclassified | 1052 |
| 14 | Ga0123353_11326820 | 3300010167 | Bacteria | 932 |
| 15 | JGI24702J35022_10092685 | 3300002462 | Bacteria | 1646 |
| 16 | Ga0072940_1159705 | 3300005200 | Unclassified | 2360 |
| 17 | Ga0466700_127152 | 3300042600 | Unclassified | 10452 |
| 18 | Ga0466707_134269 | 3300042601 | Unclassified | 1400 |
| 19 | Ga0466707_150140 | 3300042601 | Bacteria | 4151 |
| 20 | Ga0466716_081876 | 3300042605 | Bacteria | 1682 |
| 21 | Ga0466698_495683 | 3300042610 | Unclassified | 1890 |
| 22 | Ga0466690_412212 | 3300042590 | Bacteria | 1841 |
| 23 | Ga0466693_053317 | 3300042592 | Bacteria | 1625 |
| 24 | Ga0466705_114953 | 3300042612 | Bacteria | 94934 |
| 25 | Ga0466709_220148 | 3300042648 | Bacteria | 3767 |
| 26 | Ga0466715_227439 | 3300042616 | Unclassified | 15599 |
| 27 | Ga0466718_145041 | 3300042617 | Unclassified | 2126 |
| 28 | Ga0466723_031893 | 3300042618 | Bacteria | 28200 |
| 29 | Ga0123356_10000074 | 3300010049 | Bacteria | 105474 |
| 30 | Ga0123356_10001232 | 3300010049 | Bacteria | 28423 |
| 31 | Ga0123356_10007236 | 3300010049 | Bacteria | 11093 |
| 32 | Ga0123356_10021378 | 3300010049 | Bacteria | 6108 |
| 33 | Ga0123356_10080963 | 3300010049 | Bacteria | 3071 |
| 34 | Ga0123356_10111010 | 3300010049 | Bacteria | 2649 |
| 35 | Ga0123356_10125455 | 3300010049 | Bacteria | 2505 |
| 36 | Ga0123356_10153797 | 3300010049 | Bacteria | 2288 |
| 37 | Ga0123356_10897467 | 3300010049 | Bacteria | 1057 |
| 38 | Ga0123353_10096461 | 3300010167 | Bacteria | 4765 |
| 39 | Ga0123353_10111534 | 3300010167 | Bacteria | 4405 |
| 40 | Ga0123353_10285386 | 3300010167 | Bacteria | 2532 |
| 41 | Ga0123353_10901694 | 3300010167 | Bacteria | 1203 |
| 42 | Ga0123353_10998912 | 3300010167 | Bacteria | 1125 |
| 43 | Ga0466704_024941 | 3300042643 | Bacteria | 1789 |
| 44 | Ga0466715_287355 | 3300042616 | Bacteria | 29422 |
| 45 | Ga0123356_10039490 | 3300010049 | Bacteria | 4397 |
| 46 | Ga0123356_10046833 | 3300010049 | Bacteria | 4023 |
| 47 | Ga0123356_10069483 | 3300010049 | Bacteria | 3303 |
| 48 | Ga0123356_10149664 | 3300010049 | Bacteria | 2315 |
| 49 | Ga0123356_10919438 | 3300010049 | Unclassified | 1046 |
| 50 | Ga0123353_10115309 | 3300010167 | Bacteria | 4324 |
| 51 | Ga0123353_10889644 | 3300010167 | Bacteria | 1214 |
| 52 | Ga0068305_10351199 | 3300005083 | Unclassified | 1115 |
| 53 | Ga0466707_039563 | 3300042601 | Bacteria | 1767 |
| 54 | Ga0466713_021513 | 3300042602 | Bacteria | 72004 |
| 55 | Ga0415639_143974 | 3300038395 | Bacteria | 4158 |
| 56 | Ga0123356_10004767 | 3300010049 | Bacteria | 13953 |
| 57 | Ga0123356_10084293 | 3300010049 | Bacteria | 3012 |
| 58 | Ga0123356_10192698 | 3300010049 | Bacteria | 2071 |
| 59 | Ga0123356_10607271 | 3300010049 | Bacteria | 1259 |
| 60 | Ga0123356_10786131 | 3300010049 | Bacteria | 1123 |
| 61 | Ga0123356_11533192 | 3300010049 | Bacteria | 823 |
| 62 | Ga0123356_12685142 | 3300010049 | Bacteria | 623 |
| 63 | Ga0123353_10212307 | 3300010167 | Bacteria | 3035 |
| 64 | JGI24702J35022_10000007 | 3300002462 | Bacteria | 87099 |
| 65 | JGI24702J35022_10039535 | 3300002462 | Bacteria | 2516 |
| 66 | Ga0068305_10384051 | 3300005083 | Unclassified | 2305 |
| 67 | Ga0466707_229444 | 3300042601 | Bacteria | 4298 |
| 68 | Ga0466707_291010 | 3300042601 | Bacteria | 3817 |
| 69 | Ga0466707_420741 | 3300042601 | Bacteria | 4638 |
| 70 | Ga0466717_196309 | 3300042604 | Unclassified | 2030 |
| 71 | Ga0466719_493127 | 3300042606 | Bacteria | 1302 |
| 72 | Ga0466656_017648 | 3300042550 | Bacteria | 1284 |
| 73 | Ga0466694_152051 | 3300042594 | Unclassified | 4109 |
| 74 | Ga0466694_318077 | 3300042594 | Unclassified | 2010 |
| 75 | Ga0466699_272055 | 3300042597 | Bacteria | 1878 |
| 76 | Ga0466715_329047 | 3300042616 | Bacteria | 18764 |
| 77 | Ga0466718_159379 | 3300042617 | Archaea | 3174 |
| 78 | Ga0123355_10213243 | 3300009826 | Bacteria | 2793 |
| 79 | Ga0123355_10629014 | 3300009826 | Bacteria | 1262 |
| 80 | Ga0123356_10032274 | 3300010049 | Bacteria | 4900 |
| 81 | Ga0123356_10127038 | 3300010049 | Bacteria | 2491 |
| 82 | Ga0123356_10205816 | 3300010049 | Bacteria | 2012 |
| 83 | Ga0123356_10215559 | 3300010049 | Unclassified | 1972 |
| 84 | Ga0123356_10233461 | 3300010049 | Bacteria | 1905 |
| 85 | Ga0123356_10274078 | 3300010049 | Bacteria | 1778 |
| 86 | Ga0123356_10381056 | 3300010049 | Bacteria | 1543 |
| 87 | Ga0123356_11234525 | 3300010049 | Unclassified | 913 |
| 88 | Ga0123353_10009546 | 3300010167 | Bacteria | 13413 |
| 89 | Ga0123353_10066640 | 3300010167 | Bacteria | 5780 |
| 90 | Ga0123353_10075084 | 3300010167 | Bacteria | 5433 |
| 91 | Ga0123353_10186893 | 3300010167 | Bacteria | 3275 |
| 92 | Ga0123353_10249849 | 3300010167 | Bacteria | 2748 |
| 93 | Ga0123353_10696721 | 3300010167 | Bacteria | 1427 |
| 94 | Ga0123353_10703396 | 3300010167 | Bacteria | 1418 |
| 95 | Ga0123353_11459069 | 3300010167 | Bacteria | 875 |
| 96 | Ga0123353_11579371 | 3300010167 | Bacteria | 830 |
| 97 | Ga0466701_060934 | 3300042598 | Bacteria | 1156 |
| 98 | Ga0466707_090059 | 3300042601 | Bacteria | 1019 |
| 99 | Ga0466719_305116 | 3300042606 | Bacteria | 4413 |
| 100 | Ga0415639_004281 | 3300038395 | Bacteria | 1262 |
| 101 | Ga0466696_050672 | 3300042596 | Bacteria | 3225 |
| 102 | Ga0466734_005257 | 3300042623 | Bacteria | 7675 |
| 103 | Ga0466734_056386 | 3300042623 | Bacteria | 1602 |
| 104 | Ga0466702_201458 | 3300042635 | Bacteria | 11755 |
| 105 | Ga0466709_256843 | 3300042648 | Bacteria | 2291 |
| 106 | Ga0466708_186399 | 3300042652 | Bacteria | 63543 |
| 107 | Ga0466705_503237 | 3300042612 | Bacteria | 3745 |
| 108 | Ga0123357_10091692 | 3300009784 | Bacteria | 3956 |
| 109 | Ga0123355_10000479 | 3300009826 | Bacteria | 53101 |
| 110 | Ga0123355_10013532 | 3300009826 | Bacteria | 12710 |
| 111 | Ga0123355_10073833 | 3300009826 | Bacteria | 5464 |
| 112 | Ga0123355_10636621 | 3300009826 | Unclassified | 1250 |
| 113 | Ga0123356_10026426 | 3300010049 | Unclassified | 5448 |
| 114 | Ga0123356_10032030 | 3300010049 | Bacteria | 4921 |
| 115 | Ga0123356_10036962 | 3300010049 | Bacteria | 4558 |
| 116 | Ga0123356_10048543 | 3300010049 | Bacteria | 3951 |
| 117 | Ga0123356_10218395 | 3300010049 | Bacteria | 1961 |
| 118 | Ga0123356_10446521 | 3300010049 | Bacteria | 1441 |
| 119 | Ga0123356_10590140 | 3300010049 | Bacteria | 1275 |
| 120 | Ga0123353_10018923 | 3300010167 | Bacteria | 10211 |
| 121 | Ga0123353_10037597 | 3300010167 | Bacteria | 7596 |
| 122 | Ga0123353_10130450 | 3300010167 | Bacteria | 4034 |
| 123 | Ga0123353_10173747 | 3300010167 | Bacteria | 3418 |
| 124 | Ga0123353_11202229 | 3300010167 | Bacteria | 995 |
| 125 | Ga0123353_11587140 | 3300010167 | Bacteria | 827 |
| 126 | Ga0123354_10000413 | 3300010882 | Bacteria | 41600 |
| 127 | Ga0123354_10101479 | 3300010882 | Bacteria | 3885 |
| 128 | Ga0123354_10309334 | 3300010882 | Bacteria | 1479 |
| 129 | Ga0466700_149111 | 3300042600 | Bacteria | 2260 |
| 130 | Ga0466713_048293 | 3300042602 | Unclassified | 67616 |
| 131 | Ga0466716_020222 | 3300042605 | Bacteria | 4533 |
| 132 | Ga0466716_240092 | 3300042605 | Bacteria | 1269 |
| 133 | Ga0466721_297058 | 3300042608 | Bacteria | 10682 |
| 134 | Ga0466699_128927 | 3300042597 | Unclassified | 1250 |
| 135 | Ga0466705_220140 | 3300042612 | Bacteria | 12275 |
| 136 | Ga0466705_310880 | 3300042612 | Bacteria | 6887 |
| 137 | Ga0466734_015771 | 3300042623 | Unclassified | 3095 |
| 138 | Ga0466734_142486 | 3300042623 | Bacteria | 9349 |
| 139 | Ga0466702_194244 | 3300042635 | Bacteria | 1265 |
| 140 | Ga0466708_113464 | 3300042652 | Bacteria | 1858 |
| 141 | Ga0466715_639179 | 3300042616 | Bacteria | 2801 |
| 142 | Ga0466728_175978 | 3300042620 | Bacteria | 4049 |
| 143 | Ga0466728_419799 | 3300042620 | Bacteria | 2069 |
| 144 | Ga0123356_10001418 | 3300010049 | Bacteria | 26511 |
| 145 | Ga0123356_10006073 | 3300010049 | Bacteria | 12250 |
| 146 | Ga0123356_10021634 | 3300010049 | Unclassified | 6069 |
| 147 | Ga0123356_10234294 | 3300010049 | Unclassified | 1902 |
| 148 | Ga0123356_10236820 | 3300010049 | Bacteria | 1894 |
| 149 | Ga0123356_10298304 | 3300010049 | Bacteria | 1715 |
| 150 | Ga0123356_10364461 | 3300010049 | Bacteria | 1573 |
| 151 | Ga0123356_11115882 | 3300010049 | Bacteria | 957 |
| 152 | Ga0123353_10000566 | 3300010167 | Bacteria | 45539 |
| 153 | Ga0123353_10371457 | 3300010167 | Bacteria | 2144 |
| 154 | Ga0466707_219366 | 3300042601 | Bacteria | 3595 |
| 155 | Ga0466699_046418 | 3300042597 | Bacteria | 1149 |
| 156 | Ga0466705_370711 | 3300042612 | Bacteria | 21987 |
| 157 | Ga0466703_001518 | 3300042636 | Bacteria | 2118 |
| 158 | Ga0123356_10008217 | 3300010049 | Bacteria | 10386 |
| 159 | Ga0123356_10041116 | 3300010049 | Bacteria | 4308 |
| 160 | Ga0123356_10282228 | 3300010049 | Bacteria | 1757 |
| 161 | Ga0123356_10489599 | 3300010049 | Bacteria | 1384 |
| 162 | Ga0123353_10013973 | 3300010167 | Archaea | 11547 |
| 163 | Ga0123353_10396641 | 3300010167 | Bacteria | 2056 |
| 164 | JGI24702J35022_10000730 | 3300002462 | Bacteria | 20220 |
| 165 | JGI24705J35276_12110519 | 3300002504 | Bacteria | 1042 |
| 166 | JGI24705J35276_12238256 | 3300002504 | Bacteria | 18004 |
| 167 | Ga0466719_325001 | 3300042606 | Bacteria | 1054 |
| 168 | Ga0466721_091865 | 3300042608 | Bacteria | 2320 |
| 169 | Ga0415639_229617 | 3300038395 | Bacteria | 3050 |
| 170 | Ga0466691_210285 | 3300042593 | Bacteria | 16870 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF12225 | DUF5981 | Methylene-tetrahydrofolate reductase C terminal | 136 | 230 | 0.97 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.