Protein Family IF02409

Metagenome Isolate
110 Members
45 Samples
97 Scaffolds
121.62 Avg Length

🧬 Representative Sequence

ID
3300009826|Ga0123355_10048815|Ga0123355_100488156
Length
139 aa
Sequence
MIVWACRHTIAIVQKGKFKMNIKLFDSELKVMEVIWKEGDITAKALAEILGKSIGWNKNTTYTVIKKCVEKGAIERLEPNFICHALVSKEDIQGSEIDELVEKLFDGSTELLFASLVGHKKLPDHMVEKLKQIVGDSK*

📊 Sample Types

Isolate 11.8%
Metagenome 88.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 50.0%
Unclassified 22.7%
Kalotermitidae 9.1%
Blattidae 6.8%
Termopsidae 6.8%
Rhinotermitidae 2.3%
Passalidae 2.3%

🌳 Taxonomy

Archaea 1
Bacteria 98
Eukaryota 0
Viruses 0
Unclassified 11

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940419646 Paenibacillus sp. PastF-4 Isolate Blattidae
2 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
3 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
4 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
5 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
6 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
7 2820590132 Unclassified Firmicutes Emb289P1bin84 Isolate Unclassified
8 2820596822 Unclassified Firmicutes Emb289P1bin58 Isolate Unclassified
9 2940425923 Paenibacillus sp. PastH-4 Isolate Blattidae
10 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
11 2820479655 Unclassified Firmicutes Lab288P1bin77 Isolate Unclassified
12 2820593525 Unclassified Firmicutes Emb289P1bin7 Isolate Unclassified
13 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
14 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
15 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
16 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
17 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
18 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
19 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
20 2820623020 Unclassified Firmicutes Emb289P1bin126 Isolate Unclassified
21 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
22 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
23 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
24 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
25 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
26 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
27 2820309449 Unclassified Firmicutes Th196P1bin10 Isolate Unclassified
28 2820600392 Unclassified Firmicutes Emb289P1bin52 Isolate Unclassified
29 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
30 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
31 3300001880 Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome Metagenome
32 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
33 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
34 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
35 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
36 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
37 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
38 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
39 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
40 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
41 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
42 2820362221 Unclassified Firmicutes Nt197P3bin116 Isolate Unclassified
43 2820401926 Unclassified Firmicutes Mp193P1bin2 Isolate Unclassified
44 2820647881 Unclassified Firmicutes Cu122P5bin16 Isolate Unclassified
45 2940413413 Paenibacillus sp. PastH-3 Isolate Blattidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466712_172202 3300042614 Archaea 1225
2 Ga0466715_211062 3300042616 Bacteria 20965
3 Ga0123355_10006071 3300009826 Bacteria 17807
4 Ga0123355_10024632 3300009826 Bacteria 9676
5 Ga0123355_10026423 3300009826 Bacteria 9365
6 Ga0123355_10031111 3300009826 Bacteria 8658
7 Ga0123355_10345512 3300009826 Bacteria 1977
8 Ga0123355_10367218 3300009826 Bacteria 1889
9 Ga0123355_10439293 3300009826 Bacteria 1653
10 Ga0123356_10870618 3300010049 Bacteria 1072
11 Ga0123353_10672573 3300010167 Bacteria 1460
12 Ga0466735_154254 3300042624 Bacteria 2564
13 Ga0466727_328482 3300042655 Bacteria 9773
14 FAAS_10843733 3300001880 Unclassified 536
15 Ga0466697_266190 3300042611 Bacteria 1652
16 Ga0466733_090766 3300042659 Bacteria 7272
17 Ga0466711_461645 3300042615 Bacteria 1741
18 Ga0466726_159068 3300042619 Bacteria 1873
19 Ga0466726_327902 3300042619 Bacteria 3626
20 Ga0123355_10178630 3300009826 Bacteria 3155
21 Ga0123355_10418368 3300009826 Bacteria 1714
22 Ga0123355_10778664 3300009826 Bacteria 1073
23 Ga0123356_11056596 3300010049 Bacteria 981
24 Ga0123354_10526229 3300010882 Unclassified 905
25 Ga0466719_087284 3300042606 Bacteria 2076
26 Ga0466702_031557 3300042635 Bacteria 3863
27 Ga0466725_220231 3300042654 Bacteria 6696
28 JGI24703J35330_11748839 3300002501 Bacteria 46128
29 JGI24705J35276_11907662 3300002504 Bacteria 757
30 Ga0466694_192196 3300042594 Bacteria 6628
31 Ga0123355_10001127 3300009826 Bacteria 37010
32 Ga0123355_10018139 3300009826 Bacteria 11148
33 Ga0123355_10486437 3300009826 Bacteria 1532
34 Ga0123355_10662383 3300009826 Bacteria 1214
35 Ga0123355_10676858 3300009826 Bacteria 1194
36 Ga0123355_10827163 3300009826 Bacteria 1025
37 Ga0123355_11254982 3300009826 Bacteria 749
38 Ga0123356_10786917 3300010049 Bacteria 1122
39 Ga0123353_11994333 3300010167 Bacteria 711
40 Ga0466700_056320 3300042600 Bacteria 1198
41 Ga0466734_027504 3300042623 Bacteria 1074
42 Ga0466702_053126 3300042635 Bacteria 19544
43 IMNBL1DRAFT_c0006280 3300000062 Bacteria 6523
44 Ga0466710_249413 3300042613 Bacteria 1294
45 Ga0123355_10012646 3300009826 Bacteria 13085
46 Ga0123355_10145665 3300009826 Bacteria 3612
47 Ga0123355_10208498 3300009826 Bacteria 2838
48 Ga0123355_10461105 3300009826 Unclassified 1595
49 Ga0123355_10666236 3300009826 Bacteria 1208
50 Ga0123353_11567658 3300010167 Unclassified 834
51 Ga0466703_431047 3300042636 Bacteria 1504
52 JGI24697J35500_11274964 3300002507 Bacteria 32542
53 Ga0466726_265519 3300042619 Bacteria 3165
54 Ga0415639_036218 3300038395 Bacteria 7523
55 Ga0466693_330394 3300042592 Unclassified 2294
56 Ga0123355_10011679 3300009826 Bacteria 13557
57 Ga0123355_10128188 3300009826 Bacteria 3915
58 Ga0123356_10284863 3300010049 Bacteria 1750
59 Ga0123356_12589934 3300010049 Bacteria 635
60 Ga0466721_252132 3300042608 Bacteria 3633
61 Ga0466731_196689 3300042622 Unclassified 2839
62 Ga0466702_050613 3300042635 Bacteria 1095
63 Ga0466715_101965 3300042616 Bacteria 5676
64 Ga0466729_167322 3300042621 Bacteria 3113
65 Ga0415639_062854 3300038395 Bacteria 4772
66 Ga0123355_10000795 3300009826 Bacteria 43162
67 Ga0123355_10027906 3300009826 Bacteria 9123
68 Ga0123355_10762223 3300009826 Bacteria 1091
69 Ga0123356_10267084 3300010049 Bacteria 1798
70 Ga0123353_10388504 3300010167 Bacteria 2083
71 Ga0123353_11219355 3300010167 Bacteria 985
72 Ga0123353_12368241 3300010167 Bacteria 636
73 Ga0466734_047534 3300042623 Bacteria 1131
74 JGI24700J35501_10930502 3300002508 Bacteria 14774
75 Ga0466726_160548 3300042619 Bacteria 2342
76 Ga0415639_133440 3300038395 Bacteria 2342
77 Ga0466693_373227 3300042592 Unclassified 1569
78 Ga0123355_10000259 3300009826 Bacteria 67788
79 Ga0123355_10000979 3300009826 Bacteria 39620
80 Ga0123355_10058294 3300009826 Bacteria 6246
81 Ga0123355_10347583 3300009826 Bacteria 1969
82 Ga0123355_10676226 3300009826 Bacteria 1195
83 Ga0123356_10399119 3300010049 Bacteria 1512
84 Ga0123353_11428072 3300010167 Bacteria 887
85 Ga0466700_367004 3300042600 Bacteria 1985
86 Ga0466717_246305 3300042604 Bacteria 1204
87 Ga0466735_134608 3300042624 Bacteria 1737
88 IMNBL1DRAFT_c0003886 3300000062 Bacteria 9281
89 Ga0415639_084681 3300038395 Unclassified 1317
90 Ga0123355_10048815 3300009826 Bacteria 6883
91 Ga0123355_10204735 3300009826 Bacteria 2874
92 Ga0123355_10362028 3300009826 Unclassified 1910
93 Ga0123355_10430597 3300009826 Bacteria 1678
94 Ga0123355_10559622 3300009826 Unclassified 1378
95 Ga0123353_11108693 3300010167 Unclassified 1050
96 Ga0466721_035079 3300042608 Bacteria 1319
97 JGI24703J35330_11075515 3300002501 Bacteria 676

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042616 Ga0466715_211062 Ga0466715_211062_2267_2617 116
2 3300038395 Ga0415639_084681 Ga0415639_084681_47_400 117
3 3300038395 Ga0415639_133440 Ga0415639_133440_1838_2191 117
4 3300042611 Ga0466697_266190 Ga0466697_266190_179_532 117
5 3300042613 Ga0466710_249413 Ga0466710_249413_349_702 117
6 3300042619 Ga0466726_159068 Ga0466726_159068_838_1191 117
7 3300042635 Ga0466702_053126 Ga0466702_053126_14727_15080 117
8 3300042655 Ga0466727_328482 Ga0466727_328482_2415_2768 117
9 3300002501 JGI24703J35330_11748839 JGI24703J35330_1174883934 118
10 3300002504 JGI24705J35276_11907662 JGI24705J35276_119076621 118
11 3300009826 Ga0123355_10128188 Ga0123355_101281882 118
12 3300009826 Ga0123355_10662383 Ga0123355_106623832 118
13 3300010049 Ga0123356_10870618 Ga0123356_108706182 118
14 3300010167 Ga0123353_11108693 Ga0123353_111086931 118
15 3300010167 Ga0123353_12368241 Ga0123353_123682411 118
16 3300042594 Ga0466694_192196 Ga0466694_192196_3255_3611 118
17 3300042600 Ga0466700_056320 Ga0466700_056320_686_1042 118
18 3300042606 Ga0466719_087284 Ga0466719_087284_680_1036 118
19 3300042635 Ga0466702_050613 Ga0466702_050613_122_478 118
20 3300042636 Ga0466703_431047 Ga0466703_431047_1072_1428 118
21 iso_pr_bacteria 2820590132 2820591154 118
22 3300000062 IMNBL1DRAFT_c0003886 IMNBL1DRAFT_00038866 119
23 3300000062 IMNBL1DRAFT_c0006280 IMNBL1DRAFT_00062808 119
24 3300009826 Ga0123355_10031111 Ga0123355_100311115 119
25 3300010049 Ga0123356_10399119 Ga0123356_103991192 119
26 3300010167 Ga0123353_11219355 Ga0123353_112193552 119
27 3300010167 Ga0123353_11428072 Ga0123353_114280721 119
28 3300038395 Ga0415639_036218 Ga0415639_036218_4867_5226 119
29 3300042600 Ga0466700_367004 Ga0466700_367004_716_1075 119
30 3300042623 Ga0466734_027504 Ga0466734_027504_66_425 119
31 3300042623 Ga0466734_047534 Ga0466734_047534_296_655 119
32 3300042654 Ga0466725_220231 Ga0466725_220231_719_1078 119
33 3300042659 Ga0466733_090766 Ga0466733_090766_3659_4018 119
34 iso_pr_bacteria 2820401926 2820403589 119
35 iso_pr_bacteria 2820479655 2820481023 119
36 iso_pr_bacteria 2820593525 2820593964 119
37 iso_pr_bacteria 2820596822 2820597026 119
38 iso_pr_bacteria 2820647881 2820650773 119
39 iso_pr_bacteria 2940413413 2940413891 119
40 iso_pr_bacteria 2940419646 2940421323 119
41 iso_pr_bacteria 2940425923 2940427590 119
42 3300001880 FAAS_10843733 FAAS_108437332 120
43 3300002507 JGI24697J35500_11274964 JGI24697J35500_1127496426 120
44 3300009826 Ga0123355_10000259 Ga0123355_1000025929 120
45 3300009826 Ga0123355_10012646 Ga0123355_100126462 120
46 3300009826 Ga0123355_10027906 Ga0123355_100279065 120
47 3300009826 Ga0123355_10145665 Ga0123355_101456652 120
48 3300009826 Ga0123355_10178630 Ga0123355_101786301 120
49 3300009826 Ga0123355_10204735 Ga0123355_102047355 120
50 3300009826 Ga0123355_10347583 Ga0123355_103475832 120
51 3300009826 Ga0123355_10418368 Ga0123355_104183682 120
52 3300009826 Ga0123355_10430597 Ga0123355_104305972 120
53 3300009826 Ga0123355_10486437 Ga0123355_104864372 120
54 3300009826 Ga0123355_10559622 Ga0123355_105596222 120
55 3300009826 Ga0123355_10778664 Ga0123355_107786642 120
56 3300009826 Ga0123355_11254982 Ga0123355_112549821 120
57 3300010049 Ga0123356_10284863 Ga0123356_102848631 120
58 3300010049 Ga0123356_10786917 Ga0123356_107869172 120
59 3300010049 Ga0123356_12589934 Ga0123356_125899341 120
60 3300010167 Ga0123353_10388504 Ga0123353_103885042 120
61 iso_pr_bacteria 2820362221 2820362971 120
62 3300009826 Ga0123355_10024632 Ga0123355_1002463213 121
63 3300009826 Ga0123355_10208498 Ga0123355_102084983 121
64 3300009826 Ga0123355_10762223 Ga0123355_107622232 121
65 3300010049 Ga0123356_11056596 Ga0123356_110565961 121
66 3300042614 Ga0466712_172202 Ga0466712_172202_793_1158 121
67 3300009826 Ga0123355_10666236 Ga0123355_106662362 122
68 3300038395 Ga0415639_062854 Ga0415639_062854_3072_3440 122
69 3300042604 Ga0466717_246305 Ga0466717_246305_681_1049 122
70 3300042608 Ga0466721_035079 Ga0466721_035079_114_482 122
71 3300042616 Ga0466715_101965 Ga0466715_101965_1264_1632 122
72 3300042621 Ga0466729_167322 Ga0466729_167322_222_590 122
73 3300009826 Ga0123355_10006071 Ga0123355_1000607110 123
74 3300009826 Ga0123355_10026423 Ga0123355_100264238 123
75 3300009826 Ga0123355_10345512 Ga0123355_103455122 123
76 3300009826 Ga0123355_10367218 Ga0123355_103672181 123
77 3300009826 Ga0123355_10827163 Ga0123355_108271632 123
78 3300010167 Ga0123353_10672573 Ga0123353_106725732 123
79 3300010167 Ga0123353_11567658 Ga0123353_115676581 123
80 3300010167 Ga0123353_11994333 Ga0123353_119943331 123
81 3300042619 Ga0466726_160548 Ga0466726_160548_684_1055 123
82 3300042619 Ga0466726_265519 Ga0466726_265519_972_1343 123
83 3300042619 Ga0466726_327902 Ga0466726_327902_595_966 123
84 3300042624 Ga0466735_154254 Ga0466735_154254_1305_1676 123
85 iso_pr_bacteria 2820623020 2820624680 123
86 3300009826 Ga0123355_10000795 Ga0123355_1000079511 124
87 3300009826 Ga0123355_10000979 Ga0123355_1000097932 124
88 3300009826 Ga0123355_10362028 Ga0123355_103620282 124
89 3300009826 Ga0123355_10439293 Ga0123355_104392932 124
90 3300009826 Ga0123355_10461105 Ga0123355_104611051 124
91 3300009826 Ga0123355_10676858 Ga0123355_106768582 124
92 3300042635 Ga0466702_031557 Ga0466702_031557_3082_3456 124
93 iso_pr_bacteria 2820309449 2820310441 124
94 3300002508 JGI24700J35501_10930502 JGI24700J35501_1093050213 125
95 3300042608 Ga0466721_252132 Ga0466721_252132_2137_2514 125
96 3300009826 Ga0123355_10058294 Ga0123355_100582945 126
97 3300010049 Ga0123356_10267084 Ga0123356_102670842 126
98 3300002501 JGI24703J35330_11075515 JGI24703J35330_110755152 127
99 3300009826 Ga0123355_10676226 Ga0123355_106762262 127
100 3300042592 Ga0466693_330394 Ga0466693_330394_46_429 127
101 3300042624 Ga0466735_134608 Ga0466735_134608_93_476 127
102 3300009826 Ga0123355_10018139 Ga0123355_100181392 129
103 3300010882 Ga0123354_10526229 Ga0123354_105262292 129
104 3300042592 Ga0466693_373227 Ga0466693_373227_852_1241 129
105 3300042615 Ga0466711_461645 Ga0466711_461645_660_1049 129
106 iso_pr_bacteria 2820600392 2820601374 132
107 3300009826 Ga0123355_10001127 Ga0123355_1000112713 133
108 3300009826 Ga0123355_10011679 Ga0123355_100116797 135
109 3300042622 Ga0466731_196689 Ga0466731_196689_2228_2638 136
110 3300009826 Ga0123355_10048815 Ga0123355_100488156 139

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF03965 Penicillinase_R Penicillinase repressor 26 134 0.97

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.67 0.8 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.