Protein Family IF02402

Metagenome Isolate
146 Members
73 Samples
107 Scaffolds
362.27 Avg Length

🧬 Representative Sequence

ID
3300009826|Ga0123355_10041738|Ga0123355_100417384
Length
420 aa
Sequence
VAEALLRVLYELVQMMSSVLFILVHNQLKNNYILISSWAKRLIMVLSSHKITRRNSTMPESGMNYAPKGKPAPVVKPGDFTFAAIGLDHGHIGGMCNGLIEAGASLKWIYDPDPKKVESYLAMYPGAKAARSEAEVLQDKDVAMIASAAIPSDRCAIGLRAMEAGKDYFVDKAPLTTLSQLEQAKAMAAKTGKKYAVYYSERLHSEAGIFAGQLIEDGAIGKVVQTIGMGPHRANIGNRPPWFLRREQNGGILCDIGSHQIEQFLYFTGAKDAEIMAAQIENYKYPDYPGIDDFGDCTLKGDNGATGYFRVDWLTPDGLRTWGDGRTFILGTNGYIELRKYLDVGKDGKGSNVILVNNEVEQLINVEGKVGFPYFGQLILDCLNRTENAMTQEHAFKAAELCVKAQMVAEQAKGIIRDE*

📊 Sample Types

Isolate 26.7%
Metagenome 73.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 54.3%
Termitidae 30.0%
Kalotermitidae 10.0%
Hodotermitidae 1.4%
Armadillidiidae 1.4%
Termopsidae 1.4%
Scarabaeidae 1.4%

🌳 Taxonomy

Archaea 0
Bacteria 142
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820809073 Unclassified Actinobacteria Nt197P3bin55 Isolate Unclassified
2 2820329821 Unclassified Firmicutes Nt197P3bin77 Isolate Unclassified
3 2820378768 Unclassified Firmicutes Nt197P1bin7 Isolate Unclassified
4 2820382897 Unclassified Firmicutes Nt197P1bin3 Isolate Unclassified
5 2820513949 Unclassified Firmicutes Lab288P1bin39 Isolate Unclassified
6 2820617402 Unclassified Firmicutes Emb289P1bin131 Isolate Unclassified
7 2820627938 Unclassified Firmicutes Emb289P1bin122 Isolate Unclassified
8 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
9 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
10 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
11 2781125683 Treponema sp. Lab288P1bin34 Isolate Unclassified
12 2820306284 Unclassified Firmicutes Th196P1bin11 Isolate Unclassified
13 2820435670 Unclassified Firmicutes Lab288P3bin217 Isolate Unclassified
14 2820602899 Unclassified Firmicutes Emb289P1bin51 Isolate Unclassified
15 2820698910 Unclassified Firmicutes Co191P1bin64 Isolate Unclassified
16 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
17 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
18 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
19 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
20 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
21 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
22 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
23 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
24 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
25 2820298281 Unclassified Firmicutes Th196P1bin9 Isolate Unclassified
26 2820623020 Unclassified Firmicutes Emb289P1bin126 Isolate Unclassified
27 2820696217 Unclassified Firmicutes Co191P1bin66 Isolate Unclassified
28 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
29 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
30 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
31 2820897376 Unclassified Actinobacteria Lab288P1bin101 Isolate Unclassified
32 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
33 2820619171 Unclassified Firmicutes Emb289P1bin130 Isolate Unclassified
34 2820630457 Unclassified Firmicutes Emb289P1bin119 Isolate Unclassified
35 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
36 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
37 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
38 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
39 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
40 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
41 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
42 2781125643 Treponema sp. Co191P3bin45 Isolate Unclassified
43 2820385248 Unclassified Firmicutes Nt197P1bin19 Isolate Unclassified
44 2820676843 Unclassified Firmicutes Co191P3bin17 Isolate Unclassified
45 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
46 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
47 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
48 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
49 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
50 2820303403 Unclassified Firmicutes Th196P1bin2 Isolate Unclassified
51 2820522177 Unclassified Firmicutes Lab288P1bin22 Isolate Unclassified
52 2820541116 Unclassified Firmicutes Lab288P1bin109 Isolate Unclassified
53 2820654856 Unclassified Firmicutes Cu122P1bin2 Isolate Unclassified
54 2820702360 Unclassified Firmicutes Co191P1bin4 Isolate Unclassified
55 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
56 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
57 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
58 2820825283 Unclassified Actinobacteria Nt197P3bin111 Isolate Unclassified
59 2820309449 Unclassified Firmicutes Th196P1bin10 Isolate Unclassified
60 2820380671 Unclassified Firmicutes Nt197P1bin4 Isolate Unclassified
61 2820600392 Unclassified Firmicutes Emb289P1bin52 Isolate Unclassified
62 2820663833 Unclassified Firmicutes Co191P3bin41 Isolate Unclassified
63 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
64 2731957681 Xylanimicrobium pachnodae JCM 13526, NBRC 107786 Isolate Scarabaeidae
65 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
66 2781125663 Treponema sp. Emb289P3bin135 Isolate Unclassified
67 2820375548 Unclassified Firmicutes Nt197P1bin8 Isolate Unclassified
68 2820472365 Unclassified Firmicutes Lab288P1bin87 Isolate Unclassified
69 2820563109 Unclassified Firmicutes Emb289P3bin58 Isolate Unclassified
70 2820615445 Unclassified Firmicutes Emb289P1bin132 Isolate Unclassified
71 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
72 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
73 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466711_382988 3300042615 Bacteria 2611
2 Ga0466723_011820 3300042618 Bacteria 1935
3 Ga0415639_000645 3300038395 Bacteria 39915
4 Ga0466699_022591 3300042597 Bacteria 1484
5 Ga0466699_199744 3300042597 Bacteria 5810
6 Ga0123355_10001243 3300009826 Bacteria 35541
7 Ga0123355_10007635 3300009826 Bacteria 16237
8 Ga0123355_10013900 3300009826 Bacteria 12550
9 Ga0123355_10032088 3300009826 Bacteria 8524
10 Ga0123355_10041738 3300009826 Bacteria 7469
11 Ga0123355_10046408 3300009826 Bacteria 7065
12 Ga0123355_10053660 3300009826 Bacteria 6534
13 Ga0466700_348795 3300042600 Bacteria 1542
14 AustNasuHG_c1003358 3300000089 Bacteria 5781
15 JGI24695J34938_10023820 3300002450 Bacteria 2946
16 JGI24700J35501_10930813 3300002508 Bacteria 25383
17 Ga0123357_10000061 3300009784 Bacteria 85874
18 Ga0466715_425772 3300042616 Bacteria 4404
19 Ga0123355_10000141 3300009826 Bacteria 86040
20 Ga0123355_10002135 3300009826 Bacteria 27915
21 Ga0123355_10008591 3300009826 Bacteria 15429
22 Ga0123355_10017177 3300009826 Bacteria 11425
23 Ga0123355_10079513 3300009826 Bacteria 5236
24 Ga0123355_10160862 3300009826 Bacteria 3383
25 Ga0123355_10180676 3300009826 Bacteria 3132
26 Ga0123355_10191103 3300009826 Bacteria 3015
27 Ga0123355_10384035 3300009826 Bacteria 1827
28 Ga0123355_10459368 3300009826 Bacteria 1599
29 Ga0123355_10599104 3300009826 Bacteria 1309
30 Ga0123353_10289379 3300010167 Bacteria 2509
31 Ga0160464_100168 3300012805 Bacteria 70349
32 Ga0466706_266616 3300042599 Bacteria 137638
33 JGI24700J35501_10930904 3300002508 Bacteria 39244
34 JGI24699J35502_11133407 3300002509 Bacteria 10367
35 Ga0415639_000644 3300038395 Bacteria 27607
36 Ga0466693_041750 3300042592 Bacteria 3849
37 Ga0123355_10000168 3300009826 Bacteria 79476
38 Ga0123355_10007845 3300009826 Bacteria 16077
39 Ga0123355_10167253 3300009826 Bacteria 3296
40 Ga0123355_10399719 3300009826 Bacteria 1773
41 Ga0123355_10437640 3300009826 Unclassified 1658
42 Ga0123356_10005113 3300010049 Bacteria 13445
43 Ga0466700_306789 3300042600 Bacteria 4849
44 JGI24703J35330_11748873 3300002501 Bacteria 177009
45 JGI24699J35502_11133791 3300002509 Bacteria 15719
46 Ga0466696_233934 3300042596 Bacteria 4095
47 Ga0123355_10086234 3300009826 Bacteria 4993
48 Ga0123355_10093837 3300009826 Bacteria 4749
49 Ga0123355_10223677 3300009826 Bacteria 2702
50 Ga0123356_10118401 3300010049 Bacteria 2571
51 Ga0466721_073053 3300042608 Bacteria 14381
52 AustNasuHG_c1003529 3300000089 Bacteria 5652
53 JGI24703J35330_11741908 3300002501 Bacteria 3614
54 Ga0068302_10158435 3300005071 Bacteria 4211
55 Ga0466708_030726 3300042652 Bacteria 4824
56 Ga0466725_391970 3300042654 Bacteria 2789
57 Ga0466718_093980 3300042617 Bacteria 3795
58 Ga0466718_122119 3300042617 Bacteria 3797
59 Ga0160467_100208 3300012829 Bacteria 76225
60 Ga0415639_125486 3300038395 Bacteria 1997
61 Ga0466694_243852 3300042594 Bacteria 3032
62 Ga0123355_10000088 3300009826 Bacteria 97566
63 Ga0123355_10000200 3300009826 Bacteria 74631
64 Ga0123355_10001973 3300009826 Bacteria 28949
65 Ga0123355_10021865 3300009826 Bacteria 10247
66 Ga0123356_10016894 3300010049 Bacteria 6952
67 Ga0123353_10152820 3300010167 Bacteria 3683
68 Ga0123353_10715915 3300010167 Bacteria 1401
69 JGI24695J34938_10000237 3300002450 Bacteria 52618
70 JGI24695J34938_10000473 3300002450 Bacteria 38985
71 JGI24703J35330_11736155 3300002501 Bacteria 3017
72 Ga0072940_1024164 3300005200 Bacteria 4612
73 Ga0072941_1184914 3300005201 Bacteria 5388
74 Ga0466718_002058 3300042617 Bacteria 5391
75 Ga0123355_10000097 3300009826 Bacteria 93968
76 Ga0123355_10000237 3300009826 Bacteria 70535
77 Ga0123355_10000766 3300009826 Bacteria 43900
78 Ga0123355_10000825 3300009826 Bacteria 42513
79 Ga0123355_10010150 3300009826 Bacteria 14394
80 Ga0123355_10176711 3300009826 Unclassified 3178
81 Ga0123356_10019388 3300010049 Bacteria 6447
82 Ga0123353_10000667 3300010167 Bacteria 41967
83 Ga0160430_102012 3300012852 Bacteria 6795
84 Ga0415639_041107 3300038395 Bacteria 3530
85 Ga0415639_094153 3300038395 Bacteria 6305
86 Ga0466690_344544 3300042590 Bacteria 3526
87 Ga0123355_10128075 3300009826 Bacteria 3918
88 Ga0466698_202125 3300042610 Bacteria 1992
89 JGI24698J34947_10031836 3300002449 Bacteria 2773
90 JGI24695J34938_10027353 3300002450 Bacteria 2697
91 JGI24703J35330_11748159 3300002501 Bacteria 11307
92 JGI24703J35330_11748393 3300002501 Bacteria 15263
93 JGI24703J35330_11748518 3300002501 Bacteria 18390
94 JGI24703J35330_11748730 3300002501 Bacteria 29434
95 JGI24700J35501_10928896 3300002508 Bacteria 8255
96 Ga0466705_169849 3300042612 Bacteria 9607
97 Ga0466712_316436 3300042614 Unclassified 3417
98 Ga0123355_10000364 3300009826 Bacteria 58670
99 Ga0123355_10007576 3300009826 Bacteria 16289
100 Ga0123355_10099632 3300009826 Bacteria 4579
101 Ga0123355_10240455 3300009826 Bacteria 2566
102 Ga0123356_10131200 3300010049 Bacteria 2455
103 Ga0123353_10019348 3300010167 Bacteria 10111
104 Ga0466700_453846 3300042600 Bacteria 13872
105 JGI24698J34947_10014760 3300002449 Unclassified 4255
106 JGI24703J35330_11747888 3300002501 Bacteria 8891
107 JGI24700J35501_10914762 3300002508 Bacteria 3880

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF22725 GFO_IDH_MocA_C3 GFO/IDH/MocA C-terminal domain 212 337 0.91
PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold 103 199 0.87
PF02894 GFO_IDH_MocA_C Oxidoreductase family, C-terminal alpha/beta domain 213 353 0.79

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01408 GO:0000166 nucleotide binding MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.