Protein Family IF02397
Metagenome
Isolate
144
Members
48
Samples
116
Scaffolds
246.86
Avg Length
Representative Sequence
- ID
- 3300009826|Ga0123355_10036645|Ga0123355_100366452
- Length
- 277 aa
- Sequence
- MTIYTPYPAHGKIVVKCYIKFCEPERLMVIIMNKFTEKFMSNEKNLAFLNETMWGPNGIRQAEELASHFTITKDMRILDLGCGLGLSALYLAQEYSAEVFATDLYADPTENYERFQSLGIADKIVPMILDATQPLPFAKGYFDVIFSVGAYNMFGDNEEMLQNLIPYLKKGGYIAVSFPGLKYEFGDNVPPEMQPFWDVPEVARTVRGIEWWKELFGKAEGIEIVNISEQACHDIAWEEYLASRNPNDEDDKWDLDMMKAEGGKYFNTIQFIAKVI*
Sample Types
Isolate
19.4%
Metagenome
80.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
56.2%
Termitidae
43.8%
Taxonomy
Archaea
2
Bacteria
137
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125656 | Treponema sp. Emb289P1bin65 | Isolate | Unclassified |
| 2 | 2820504582 | Unclassified Firmicutes Lab288P1bin5 | Isolate | Unclassified |
| 3 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 4 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 5 | 2820025825 | Unclassified Spirochaetes Lab288P1bin8 | Isolate | Unclassified |
| 6 | 2820525019 | Unclassified Firmicutes Lab288P1bin2 | Isolate | Unclassified |
| 7 | 2820570671 | Unclassified Firmicutes Emb289P3bin19 | Isolate | Unclassified |
| 8 | 2820630457 | Unclassified Firmicutes Emb289P1bin119 | Isolate | Unclassified |
| 9 | 2820637417 | Unclassified Firmicutes Emb289P1bin108 | Isolate | Unclassified |
| 10 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 11 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 12 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 13 | 2820495292 | Unclassified Firmicutes Lab288P1bin59 | Isolate | Unclassified |
| 14 | 2820602899 | Unclassified Firmicutes Emb289P1bin51 | Isolate | Unclassified |
| 15 | 2820626145 | Unclassified Firmicutes Emb289P1bin123 | Isolate | Unclassified |
| 16 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 17 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 18 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 19 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 20 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 21 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 22 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 23 | 2820220859 | Unclassified Firmicutes Th196P4bin59 | Isolate | Unclassified |
| 24 | 2820387566 | Unclassified Firmicutes Nt197P1bin1 | Isolate | Unclassified |
| 25 | 2820510699 | Unclassified Firmicutes Lab288P1bin40 | Isolate | Unclassified |
| 26 | 2820522177 | Unclassified Firmicutes Lab288P1bin22 | Isolate | Unclassified |
| 27 | 2820654856 | Unclassified Firmicutes Cu122P1bin2 | Isolate | Unclassified |
| 28 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 29 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 30 | 2820788205 | Unclassified Bacteroidetes Emb289P1bin57 | Isolate | Unclassified |
| 31 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 32 | 2820685979 | Unclassified Firmicutes Co191P1bin81 | Isolate | Unclassified |
| 33 | 2820696217 | Unclassified Firmicutes Co191P1bin66 | Isolate | Unclassified |
| 34 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 35 | 2820027804 | Unclassified Spirochaetes Lab288P1bin105 | Isolate | Unclassified |
| 36 | 2820309449 | Unclassified Firmicutes Th196P1bin10 | Isolate | Unclassified |
| 37 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 38 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 39 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 40 | 2820593525 | Unclassified Firmicutes Emb289P1bin7 | Isolate | Unclassified |
| 41 | 2820673891 | Unclassified Firmicutes Co191P3bin18 | Isolate | Unclassified |
| 42 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 43 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 44 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 45 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 46 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 47 | 2820382897 | Unclassified Firmicutes Nt197P1bin3 | Isolate | Unclassified |
| 48 | 2820535361 | Unclassified Firmicutes Lab288P1bin14 | Isolate | Unclassified |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | JGI24695J34938_10049185 | 3300002450 | Bacteria | 1854 |
| 2 | JGI24696J40584_12958692 | 3300002834 | Bacteria | 4329 |
| 3 | Ga0466695_291174 | 3300042595 | Bacteria | 4944 |
| 4 | Ga0466699_126768 | 3300042597 | Bacteria | 1378 |
| 5 | Ga0123355_10000161 | 3300009826 | Bacteria | 81946 |
| 6 | Ga0123355_10001417 | 3300009826 | Bacteria | 33467 |
| 7 | Ga0123355_10073415 | 3300009826 | Bacteria | 5483 |
| 8 | Ga0123355_10123939 | 3300009826 | Bacteria | 3999 |
| 9 | Ga0123355_10181514 | 3300009826 | Archaea | 3122 |
| 10 | Ga0123355_10224956 | 3300009826 | Bacteria | 2691 |
| 11 | Ga0123355_10402145 | 3300009826 | Bacteria | 1765 |
| 12 | Ga0123355_10447384 | 3300009826 | Unclassified | 1631 |
| 13 | Ga0123355_10463211 | 3300009826 | Bacteria | 1589 |
| 14 | Ga0466656_231358 | 3300042550 | Bacteria | 1094 |
| 15 | Ga0466699_020043 | 3300042597 | Bacteria | 3028 |
| 16 | Ga0466699_056126 | 3300042597 | Bacteria | 2057 |
| 17 | Ga0123355_10001993 | 3300009826 | Bacteria | 28832 |
| 18 | Ga0123355_10033889 | 3300009826 | Bacteria | 8294 |
| 19 | Ga0123355_10036645 | 3300009826 | Bacteria | 7976 |
| 20 | Ga0123355_10068937 | 3300009826 | Bacteria | 5687 |
| 21 | Ga0123355_10131252 | 3300009826 | Bacteria | 3860 |
| 22 | Ga0123356_10187248 | 3300010049 | Unclassified | 2097 |
| 23 | Ga0123353_10104906 | 3300010167 | Bacteria | 4554 |
| 24 | Ga0123353_10161735 | 3300010167 | Bacteria | 3564 |
| 25 | Ga0466725_064140 | 3300042654 | Bacteria | 2947 |
| 26 | Ga0466697_136266 | 3300042611 | Bacteria | 1773 |
| 27 | AustNasuHG_c1001981 | 3300000089 | Bacteria | 7364 |
| 28 | JGI24702J35022_10005076 | 3300002462 | Bacteria | 7747 |
| 29 | JGI24703J35330_11748689 | 3300002501 | Bacteria | 25214 |
| 30 | JGI24700J35501_10930819 | 3300002508 | Bacteria | 25533 |
| 31 | Ga0466656_121117 | 3300042550 | Bacteria | 1084 |
| 32 | Ga0466657_072047 | 3300042582 | Bacteria | 1290 |
| 33 | Ga0466695_202437 | 3300042595 | Bacteria | 1245 |
| 34 | Ga0466695_261484 | 3300042595 | Bacteria | 26287 |
| 35 | Ga0466699_011045 | 3300042597 | Bacteria | 5952 |
| 36 | Ga0466699_115974 | 3300042597 | Unclassified | 4913 |
| 37 | Ga0466699_150444 | 3300042597 | Bacteria | 10228 |
| 38 | Ga0123355_10015420 | 3300009826 | Bacteria | 12005 |
| 39 | Ga0123355_10127626 | 3300009826 | Bacteria | 3926 |
| 40 | Ga0123355_10171855 | 3300009826 | Bacteria | 3237 |
| 41 | Ga0123355_10268331 | 3300009826 | Bacteria | 2376 |
| 42 | Ga0123355_10551633 | 3300009826 | Bacteria | 1393 |
| 43 | Ga0466700_451735 | 3300042600 | Bacteria | 1698 |
| 44 | JGI24703J35330_11748868 | 3300002501 | Bacteria | 71721 |
| 45 | Ga0466657_187561 | 3300042582 | Bacteria | 2533 |
| 46 | Ga0466693_220584 | 3300042592 | Bacteria | 4536 |
| 47 | Ga0466693_336408 | 3300042592 | Bacteria | 1076 |
| 48 | Ga0123355_10000184 | 3300009826 | Bacteria | 77545 |
| 49 | Ga0123355_10002607 | 3300009826 | Bacteria | 25580 |
| 50 | Ga0123355_10207487 | 3300009826 | Bacteria | 2848 |
| 51 | Ga0123355_10300994 | 3300009826 | Bacteria | 2186 |
| 52 | Ga0123355_10573927 | 3300009826 | Bacteria | 1352 |
| 53 | Ga0123355_10575398 | 3300009826 | Bacteria | 1349 |
| 54 | Ga0123355_10703361 | 3300009826 | Bacteria | 1160 |
| 55 | Ga0123356_10001943 | 3300010049 | Bacteria | 22375 |
| 56 | Ga0123356_10038972 | 3300010049 | Bacteria | 4428 |
| 57 | Ga0123356_10317482 | 3300010049 | Bacteria | 1670 |
| 58 | Ga0123356_10490611 | 3300010049 | Bacteria | 1383 |
| 59 | Ga0123356_10575560 | 3300010049 | Bacteria | 1289 |
| 60 | Ga0123356_10873272 | 3300010049 | Bacteria | 1071 |
| 61 | Ga0123353_10362424 | 3300010167 | Bacteria | 2178 |
| 62 | Ga0466734_105274 | 3300042623 | Bacteria | 4293 |
| 63 | Ga0466657_142464 | 3300042582 | Archaea | 8748 |
| 64 | Ga0466699_047853 | 3300042597 | Bacteria | 4288 |
| 65 | Ga0123355_10000432 | 3300009826 | Bacteria | 55030 |
| 66 | Ga0123355_10000434 | 3300009826 | Bacteria | 54971 |
| 67 | Ga0123355_10000740 | 3300009826 | Bacteria | 44475 |
| 68 | Ga0123355_10001039 | 3300009826 | Bacteria | 38448 |
| 69 | Ga0123355_10010047 | 3300009826 | Bacteria | 14460 |
| 70 | Ga0123355_10017934 | 3300009826 | Bacteria | 11207 |
| 71 | Ga0123355_10076570 | 3300009826 | Bacteria | 5350 |
| 72 | Ga0123355_10959386 | 3300009826 | Bacteria | 916 |
| 73 | Ga0123356_10396627 | 3300010049 | Bacteria | 1516 |
| 74 | Ga0123356_10555376 | 3300010049 | Bacteria | 1310 |
| 75 | Ga0123356_10763484 | 3300010049 | Bacteria | 1137 |
| 76 | Ga0123353_10204338 | 3300010167 | Bacteria | 3104 |
| 77 | Ga0123354_10173842 | 3300010882 | Bacteria | 2492 |
| 78 | Ga0466725_279345 | 3300042654 | Bacteria | 1003 |
| 79 | Ga0466700_309588 | 3300042600 | Bacteria | 264576 |
| 80 | JGI24702J35022_10003868 | 3300002462 | Bacteria | 8982 |
| 81 | Ga0466693_150851 | 3300042592 | Bacteria | 6857 |
| 82 | Ga0123355_10005539 | 3300009826 | Bacteria | 18529 |
| 83 | Ga0123355_10112273 | 3300009826 | Bacteria | 4254 |
| 84 | Ga0123355_10187517 | 3300009826 | Bacteria | 3055 |
| 85 | Ga0123355_10209865 | 3300009826 | Bacteria | 2825 |
| 86 | Ga0123355_10355567 | 3300009826 | Bacteria | 1935 |
| 87 | Ga0123355_10904427 | 3300009826 | Bacteria | 958 |
| 88 | Ga0123356_10112017 | 3300010049 | Bacteria | 2638 |
| 89 | Ga0123356_10325866 | 3300010049 | Bacteria | 1651 |
| 90 | Ga0123356_10431785 | 3300010049 | Bacteria | 1462 |
| 91 | Ga0123353_10007599 | 3300010167 | Bacteria | 14686 |
| 92 | Ga0123353_10287688 | 3300010167 | Bacteria | 2518 |
| 93 | Ga0123353_10476318 | 3300010167 | Bacteria | 1828 |
| 94 | Ga0466700_170640 | 3300042600 | Bacteria | 2066 |
| 95 | Ga0466700_487696 | 3300042600 | Bacteria | 3041 |
| 96 | JGI24695J34938_10117557 | 3300002450 | Bacteria | 1082 |
| 97 | Ga0466695_191661 | 3300042595 | Bacteria | 2764 |
| 98 | Ga0466699_174327 | 3300042597 | Bacteria | 1496 |
| 99 | Ga0123355_10022551 | 3300009826 | Bacteria | 10092 |
| 100 | Ga0123355_10241472 | 3300009826 | Unclassified | 2558 |
| 101 | Ga0123356_10001112 | 3300010049 | Bacteria | 29815 |
| 102 | Ga0123356_10023722 | 3300010049 | Bacteria | 5771 |
| 103 | Ga0123356_10034798 | 3300010049 | Bacteria | 4707 |
| 104 | Ga0123356_10123060 | 3300010049 | Bacteria | 2527 |
| 105 | Ga0123356_10305717 | 3300010049 | Bacteria | 1697 |
| 106 | Ga0466734_050930 | 3300042623 | Bacteria | 1209 |
| 107 | Ga0466725_071820 | 3300042654 | Bacteria | 1771 |
| 108 | Ga0466697_269583 | 3300042611 | Unclassified | 10229 |
| 109 | Ga0466721_216016 | 3300042608 | Bacteria | 12611 |
| 110 | AustNasuHG_c1016218 | 3300000089 | Bacteria | 2497 |
| 111 | JGI24695J34938_10000356 | 3300002450 | Bacteria | 45139 |
| 112 | Ga0466699_011974 | 3300042597 | Bacteria | 1181 |
| 113 | Ga0466699_109646 | 3300042597 | Bacteria | 1131 |
| 114 | Ga0466699_220770 | 3300042597 | Bacteria | 1457 |
| 115 | Ga0123355_10162509 | 3300009826 | Bacteria | 3360 |
| 116 | Ga0466724_35060 | 3300042649 | Bacteria | 1200 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF13649 | Methyltransf_25 | Methyltransferase domain | 77 | 172 | 0.91 |
| PF08242 | Methyltransf_12 | Methyltransferase domain | 78 | 174 | 0.86 |
| PF13847 | Methyltransf_31 | Methyltransferase domain | 71 | 187 | 0.86 |
| PF08241 | Methyltransf_11 | Methyltransferase domain | 78 | 175 | 0.85 |
| PF02353 | CMAS | Mycolic acid cyclopropane synthetase | 68 | 174 | 0.81 |
| PF13489 | Methyltransf_23 | Methyltransferase domain | 71 | 180 | 0.79 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF08241 | GO:0008757 | S-adenosylmethionine-dependent methyltransferase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.