Protein Family IF02372
Metagenome
Isolate
227
Members
94
Samples
196
Scaffolds
330.73
Avg Length
Representative Sequence
- ID
- 3300009826|Ga0123355_10019272|Ga0123355_1001927211
- Length
- 371 aa
- Sequence
- MKLYSQKDVDRKALKGARIAILGYGSQGRAHALNLKDSGFDVVVGVRPGGKGWKQARREGLKVAPPAEAVQGADLVAVLIPDTAQKPFYQEIRKGLNAGATLLFAHGFNIHFGQIKPAKDLDVVLIAPKGPGDLVRRQYASGRGVPCLLAVAQDATGKAHARALAYAHGIGGTRGGVLETTFAEETETDLFGEQAVLCGGCTELVVKGFETLVEAGYQPEVAYYECLHELKLIVDLLHEGGLAKMHQFVSETAKYGDLTRGPRIVNERVKNEMRKVLKEVQSGRFARQWIRENAGGRPNYQKLLSGDLEHQIEKVGATLRARMPWLQETRTKAAAAGKPLAKATKPVRSTGRRAPKRGRPEGAAAARQAS*
Sample Types
Isolate
13.7%
Metagenome
86.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
31.5%
Termitidae
25.0%
Kalotermitidae
14.1%
Tenebrionidae
6.5%
Armadillidiidae
4.3%
Termopsidae
4.3%
Rhinotermitidae
3.3%
Elmidae
3.3%
Culicidae
3.3%
Passalidae
1.1%
Hodotermitidae
1.1%
Scarabaeidae
1.1%
Cerambycidae
1.1%
Taxonomy
Archaea
5
Bacteria
200
Eukaryota
0
Viruses
0
Unclassified
22
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2772190889 | Unclassified Elusimicrobia Cu122P5_bin43 | Isolate | Unclassified |
| 2 | 2791354849 | Unclassified Chloroflexi Lab288P3bin29 | Isolate | Unclassified |
| 3 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 4 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 5 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 6 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 7 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 8 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 9 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 10 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 11 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 12 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 13 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 14 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 15 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 16 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 17 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 18 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 19 | 2864866972 | Brevundimonas bullata S00123 | Isolate | Elmidae |
| 20 | 2820111668 | Unclassified Proteobacteria Emb289P4bin34 | Isolate | Unclassified |
| 21 | 642555172 | Endomicrobium trichonymphae Rs-D17 | Isolate | Unclassified |
| 22 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 23 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 24 | 2864934081 | Brevundimonas vesicularis S00192 | Isolate | Elmidae |
| 25 | 2820939604 | Unclassified Actinobacteria Emb289P1bin4 | Isolate | Unclassified |
| 26 | 2772190892 | Unclassified Elusimicrobia Lab288P3_bin37 | Isolate | Unclassified |
| 27 | 2820731983 | Unclassified Chloroflexi Nt197P3bin126 | Isolate | Unclassified |
| 28 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 29 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 30 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 31 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 32 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 33 | 2864951976 | Brevundimonas bullata S00223 | Isolate | Elmidae |
| 34 | 2820018428 | Unclassified Spirochaetes Nt197P3bin33 | Isolate | Unclassified |
| 35 | 2820551407 | Unclassified Firmicutes Emb289P4bin38 | Isolate | Unclassified |
| 36 | 2820046858 | Unclassified Proteobacteria Th196P3bin84 | Isolate | Unclassified |
| 37 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 38 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 39 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 40 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 41 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 42 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 43 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 44 | 2837204985 | Lysinimonas sp. 2DFWR-13 | Isolate | Scarabaeidae |
| 45 | 2820818506 | Unclassified Actinobacteria Nt197P3bin3 | Isolate | Unclassified |
| 46 | 2754412482 | Unclassified Elusimicrobia Emb289P3bin85 | Isolate | Unclassified |
| 47 | 2791354848 | Unclassified Chloroflexi Emb289P3bin155 | Isolate | Unclassified |
| 48 | 2820106212 | Unclassified Proteobacteria Emb289P4bin44 | Isolate | Unclassified |
| 49 | 2820520043 | Unclassified Firmicutes Lab288P1bin24 | Isolate | Unclassified |
| 50 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 51 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 52 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 53 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 54 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 55 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 56 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 57 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 58 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 59 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 60 | 2084038013 | Anoplophora glabripennis gut microbial communities from Worchester, Massachusetts, USA - Larvae | Metagenome | Cerambycidae |
| 61 | 2772190894 | Unclassified Elusimicrobia Th196P4_bin33 | Isolate | Unclassified |
| 62 | 2820590132 | Unclassified Firmicutes Emb289P1bin84 | Isolate | Unclassified |
| 63 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 64 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 65 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 66 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 67 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 68 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 69 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 70 | 2820897376 | Unclassified Actinobacteria Lab288P1bin101 | Isolate | Unclassified |
| 71 | 2838140227 | Dyella sp. OAE510 | Isolate | Unclassified |
| 72 | 2754412483 | Unclassified Elusimicrobia Lab288P4bin38 | Isolate | Unclassified |
| 73 | 2772190893 | Unclassified Elusimicrobia Nt197P4_bin29 | Isolate | Unclassified |
| 74 | 2820168331 | Unclassified Proteobacteria Co191P3bin57 | Isolate | Unclassified |
| 75 | 2820525019 | Unclassified Firmicutes Lab288P1bin2 | Isolate | Unclassified |
| 76 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 77 | 8030347546 | Propionimicrobium sp. PCR01-08-3 | Isolate | Tenebrionidae |
| 78 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 79 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 80 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 81 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 82 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 83 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 84 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 85 | 2772190891 | Unclassified Elusimicrobia Emb289P1_bin41 | Isolate | Unclassified |
| 86 | 2772190895 | Unclassified Elusimicrobia Emb289P1_bin39 | Isolate | Unclassified |
| 87 | 2820134530 | Unclassified Proteobacteria Emb289P3bin65 | Isolate | Unclassified |
| 88 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 89 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 90 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 91 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 92 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 93 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 94 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0562379_0440 | 3300056790 | Bacteria | 87979 |
| 2 | Ga0562377_1230 | 3300056842 | Bacteria | 28933 |
| 3 | Ga0466734_093279 | 3300042623 | Bacteria | 1820 |
| 4 | Ga0466703_349196 | 3300042636 | Bacteria | 2702 |
| 5 | Ga0466704_193103 | 3300042643 | Bacteria | 7988 |
| 6 | Ga0466704_363778 | 3300042643 | Bacteria | 101687 |
| 7 | Ga0466727_134580 | 3300042655 | Bacteria | 29887 |
| 8 | Ga0466727_248936 | 3300042655 | Archaea | 11752 |
| 9 | JGI24705J35276_12238779 | 3300002504 | Bacteria | 63345 |
| 10 | Ga0072940_1419954 | 3300005200 | Unclassified | 3250 |
| 11 | Ga0123357_10002388 | 3300009784 | Bacteria | 20922 |
| 12 | Ga0123356_10034934 | 3300010049 | Bacteria | 4698 |
| 13 | Ga0160436_1017466 | 3300012861 | Bacteria | 1416 |
| 14 | Ga0415639_060711 | 3300038395 | Bacteria | 1759 |
| 15 | Ga0466693_084611 | 3300042592 | Bacteria | 1418 |
| 16 | Ga0466691_026550 | 3300042593 | Bacteria | 16557 |
| 17 | Ga0466696_016847 | 3300042596 | Bacteria | 3112 |
| 18 | Ga0466699_254963 | 3300042597 | Bacteria | 15558 |
| 19 | Ga0466715_219573 | 3300042616 | Bacteria | 21570 |
| 20 | Ga0466715_297517 | 3300042616 | Bacteria | 34381 |
| 21 | Ga0466729_026352 | 3300042621 | Bacteria | 5810 |
| 22 | Ga0466713_147168 | 3300042602 | Bacteria | 19246 |
| 23 | Ga0466719_232167 | 3300042606 | Unclassified | 43186 |
| 24 | Ga0466722_056197 | 3300042609 | Archaea | 9066 |
| 25 | Ga0562378_0722 | 3300056814 | Bacteria | 47264 |
| 26 | Ga0562376_0349 | 3300056857 | Unclassified | 89347 |
| 27 | Ga0562374_0632 | 3300057007 | Bacteria | 54003 |
| 28 | Ga0466729_279861 | 3300042621 | Bacteria | 28458 |
| 29 | Ga0466735_023249 | 3300042624 | Bacteria | 20584 |
| 30 | Ga0466735_034700 | 3300042624 | Bacteria | 11742 |
| 31 | Ga0466704_094829 | 3300042643 | Bacteria | 31906 |
| 32 | Ga0466704_596461 | 3300042643 | Bacteria | 93141 |
| 33 | Ga0466708_326825 | 3300042652 | Unclassified | 5327 |
| 34 | Ga0466727_279814 | 3300042655 | Unclassified | 3839 |
| 35 | AglaG_contig07414 | 2084038013 | Bacteria | 2954 |
| 36 | JGI24702J35022_10016113 | 3300002462 | Bacteria | 4103 |
| 37 | Ga0123357_10001155 | 3300009784 | Bacteria | 27479 |
| 38 | Ga0123355_10000608 | 3300009826 | Bacteria | 48311 |
| 39 | Ga0123355_10010054 | 3300009826 | Bacteria | 14457 |
| 40 | Ga0123355_10054261 | 3300009826 | Bacteria | 6494 |
| 41 | Ga0123355_10263922 | 3300009826 | Bacteria | 2404 |
| 42 | Ga0123353_10062750 | 3300010167 | Bacteria | 5960 |
| 43 | Ga0264413_156271 | 3300024493 | Bacteria | 2227 |
| 44 | Ga0415639_061347 | 3300038395 | Bacteria | 28818 |
| 45 | Ga0466690_050591 | 3300042590 | Bacteria | 7574 |
| 46 | Ga0466715_128445 | 3300042616 | Bacteria | 10799 |
| 47 | Ga0466715_169080 | 3300042616 | Bacteria | 66239 |
| 48 | Ga0466726_025313 | 3300042619 | Bacteria | 29923 |
| 49 | Ga0466707_149726 | 3300042601 | Bacteria | 7954 |
| 50 | Ga0466719_430020 | 3300042606 | Unclassified | 2416 |
| 51 | Ga0466722_094365 | 3300042609 | Bacteria | 6791 |
| 52 | Ga0466705_335338 | 3300042612 | Bacteria | 19710 |
| 53 | Ga0466729_251483 | 3300042621 | Bacteria | 4886 |
| 54 | Ga0466729_287799 | 3300042621 | Bacteria | 27864 |
| 55 | Ga0466734_138473 | 3300042623 | Bacteria | 1662 |
| 56 | Ga0466735_081951 | 3300042624 | Bacteria | 9539 |
| 57 | Ga0466730_097032 | 3300042625 | Bacteria | 6377 |
| 58 | Ga0466704_404340 | 3300042643 | Bacteria | 11665 |
| 59 | IMNBGM34_c000668 | 3300000036 | Bacteria | 8337 |
| 60 | JGI24695J34938_10000896 | 3300002450 | Bacteria | 27514 |
| 61 | Ga0068305_10000168 | 3300005083 | Bacteria | 304006 |
| 62 | Ga0068305_10000236 | 3300005083 | Bacteria | 130548 |
| 63 | Ga0068305_10001546 | 3300005083 | Bacteria | 17451 |
| 64 | Ga0068305_10010337 | 3300005083 | Unclassified | 7837 |
| 65 | Ga0123355_10002373 | 3300009826 | Bacteria | 26626 |
| 66 | Ga0123355_10015429 | 3300009826 | Bacteria | 12001 |
| 67 | Ga0123355_10269887 | 3300009826 | Bacteria | 2366 |
| 68 | Ga0123356_10021488 | 3300010049 | Bacteria | 6090 |
| 69 | Ga0123356_10077770 | 3300010049 | Bacteria | 3130 |
| 70 | Ga0160455_100022 | 3300012837 | Bacteria | 376035 |
| 71 | Ga0160445_100011 | 3300012847 | Bacteria | 286054 |
| 72 | Ga0160448_112888 | 3300012854 | Bacteria | 1620 |
| 73 | Ga0466692_149546 | 3300042591 | Bacteria | 6922 |
| 74 | Ga0466691_097306 | 3300042593 | Bacteria | 2071 |
| 75 | Ga0466712_080171 | 3300042614 | Bacteria | 1527 |
| 76 | Ga0466711_002431 | 3300042615 | Bacteria | 5392 |
| 77 | Ga0466723_118407 | 3300042618 | Bacteria | 10161 |
| 78 | Ga0466728_332346 | 3300042620 | Unclassified | 11837 |
| 79 | Ga0466707_186188 | 3300042601 | Bacteria | 29049 |
| 80 | Ga0466714_112816 | 3300042603 | Bacteria | 1337 |
| 81 | Ga0466716_397200 | 3300042605 | Bacteria | 24828 |
| 82 | Ga0466719_040767 | 3300042606 | Bacteria | 242892 |
| 83 | Ga0466698_352096 | 3300042610 | Bacteria | 1298 |
| 84 | Ga0562379_0016 | 3300056790 | Bacteria | 1192610 |
| 85 | Ga0562376_0231 | 3300056857 | Bacteria | 111178 |
| 86 | Ga0466729_199097 | 3300042621 | Bacteria | 1130 |
| 87 | Ga0466703_250320 | 3300042636 | Bacteria | 592480 |
| 88 | Ga0072940_1004693 | 3300005200 | Bacteria | 1608 |
| 89 | Ga0123357_10000013 | 3300009784 | Bacteria | 161473 |
| 90 | Ga0123355_10021707 | 3300009826 | Bacteria | 10281 |
| 91 | Ga0123355_10155552 | 3300009826 | Bacteria | 3460 |
| 92 | Ga0123356_10000224 | 3300010049 | Bacteria | 65783 |
| 93 | Ga0160448_100002 | 3300012854 | Bacteria | 753687 |
| 94 | Ga0160435_1000140 | 3300012857 | Bacteria | 40834 |
| 95 | Ga0466690_117639 | 3300042590 | Unclassified | 9847 |
| 96 | Ga0466696_099834 | 3300042596 | Bacteria | 4451 |
| 97 | Ga0466711_171080 | 3300042615 | Bacteria | 7791 |
| 98 | Ga0466706_013807 | 3300042599 | Bacteria | 8316 |
| 99 | Ga0466706_037575 | 3300042599 | Bacteria | 87054 |
| 100 | Ga0466707_071063 | 3300042601 | Bacteria | 87067 |
| 101 | Ga0466713_020847 | 3300042602 | Unclassified | 14671 |
| 102 | Ga0466714_165425 | 3300042603 | Bacteria | 52676 |
| 103 | Ga0466719_315891 | 3300042606 | Bacteria | 13192 |
| 104 | Ga0466731_265808 | 3300042622 | Archaea | 55470 |
| 105 | Ga0466734_132472 | 3300042623 | Unclassified | 2351 |
| 106 | Ga0466704_380487 | 3300042643 | Unclassified | 3392 |
| 107 | Ga0466727_312951 | 3300042655 | Bacteria | 1979 |
| 108 | Ga0123357_10029877 | 3300009784 | Bacteria | 7388 |
| 109 | Ga0123355_10074582 | 3300009826 | Bacteria | 5435 |
| 110 | Ga0123353_10007366 | 3300010167 | Archaea | 14855 |
| 111 | Ga0123353_10046154 | 3300010167 | Bacteria | 6919 |
| 112 | Ga0466715_125599 | 3300042616 | Bacteria | 2603 |
| 113 | Ga0466723_361234 | 3300042618 | Bacteria | 9440 |
| 114 | Ga0466726_153398 | 3300042619 | Bacteria | 9523 |
| 115 | Ga0466726_198604 | 3300042619 | Bacteria | 51682 |
| 116 | Ga0466726_217236 | 3300042619 | Bacteria | 220873 |
| 117 | Ga0466728_407609 | 3300042620 | Bacteria | 161023 |
| 118 | Ga0466728_453557 | 3300042620 | Bacteria | 45857 |
| 119 | Ga0466713_148925 | 3300042602 | Bacteria | 109604 |
| 120 | Ga0466714_098282 | 3300042603 | Bacteria | 1327 |
| 121 | Ga0466719_314086 | 3300042606 | Bacteria | 9103 |
| 122 | Ga0466735_022014 | 3300042624 | Unclassified | 6627 |
| 123 | Ga0466735_056179 | 3300042624 | Bacteria | 8172 |
| 124 | Ga0466735_071777 | 3300042624 | Bacteria | 12951 |
| 125 | Ga0466703_326518 | 3300042636 | Bacteria | 1988 |
| 126 | Ga0466727_078764 | 3300042655 | Bacteria | 3475 |
| 127 | JGI24698J34947_10022405 | 3300002449 | Bacteria | 3389 |
| 128 | Ga0068302_10022794 | 3300005071 | Bacteria | 6362 |
| 129 | Ga0123357_10001905 | 3300009784 | Bacteria | 22688 |
| 130 | Ga0123355_10000334 | 3300009826 | Bacteria | 61015 |
| 131 | Ga0123355_10344691 | 3300009826 | Bacteria | 1981 |
| 132 | Ga0123356_10024157 | 3300010049 | Bacteria | 5720 |
| 133 | Ga0123353_10000308 | 3300010167 | Bacteria | 60374 |
| 134 | Ga0123353_10044345 | 3300010167 | Bacteria | 7050 |
| 135 | Ga0160468_100019 | 3300012819 | Bacteria | 312885 |
| 136 | Ga0264413_154129 | 3300024493 | Bacteria | 9060 |
| 137 | Ga0466690_208923 | 3300042590 | Bacteria | 6436 |
| 138 | Ga0466710_170927 | 3300042613 | Bacteria | 1390 |
| 139 | Ga0466711_157498 | 3300042615 | Bacteria | 313285 |
| 140 | Ga0466711_366950 | 3300042615 | Bacteria | 19010 |
| 141 | Ga0466715_333068 | 3300042616 | Bacteria | 5600 |
| 142 | Ga0466726_078640 | 3300042619 | Bacteria | 41565 |
| 143 | Ga0466726_149002 | 3300042619 | Bacteria | 14101 |
| 144 | Ga0466726_191723 | 3300042619 | Unclassified | 7691 |
| 145 | Ga0466728_179624 | 3300042620 | Bacteria | 26098 |
| 146 | Ga0466729_193334 | 3300042621 | Bacteria | 6930 |
| 147 | Ga0466706_255888 | 3300042599 | Bacteria | 36441 |
| 148 | Ga0466707_009794 | 3300042601 | Bacteria | 18360 |
| 149 | Ga0466716_394702 | 3300042605 | Bacteria | 12444 |
| 150 | Ga0466716_429343 | 3300042605 | Bacteria | 10363 |
| 151 | Ga0466719_005208 | 3300042606 | Bacteria | 4025 |
| 152 | Ga0466719_371974 | 3300042606 | Bacteria | 9355 |
| 153 | Ga0466705_042717 | 3300042612 | Bacteria | 21329 |
| 154 | Ga0466735_176045 | 3300042624 | Unclassified | 6967 |
| 155 | Ga0466730_042901 | 3300042625 | Bacteria | 1834 |
| 156 | Ga0466703_026963 | 3300042636 | Bacteria | 5941 |
| 157 | Ga0466704_608793 | 3300042643 | Bacteria | 26229 |
| 158 | Ga0466725_022142 | 3300042654 | Bacteria | 14110 |
| 159 | Ga0068305_10001041 | 3300005083 | Bacteria | 17061 |
| 160 | Ga0068305_10025443 | 3300005083 | Bacteria | 3548 |
| 161 | Ga0123355_10019272 | 3300009826 | Bacteria | 10861 |
| 162 | Ga0123355_10376409 | 3300009826 | Bacteria | 1855 |
| 163 | Ga0123353_10470834 | 3300010167 | Bacteria | 1842 |
| 164 | Ga0160433_100002 | 3300012846 | Bacteria | 625007 |
| 165 | Ga0160445_102749 | 3300012847 | Bacteria | 3877 |
| 166 | Ga0160430_100094 | 3300012852 | Bacteria | 77062 |
| 167 | Ga0466657_160770 | 3300042582 | Archaea | 2505 |
| 168 | Ga0466690_127053 | 3300042590 | Bacteria | 17624 |
| 169 | Ga0466690_141736 | 3300042590 | Bacteria | 2905 |
| 170 | Ga0466690_197002 | 3300042590 | Bacteria | 40399 |
| 171 | Ga0466691_142943 | 3300042593 | Unclassified | 4155 |
| 172 | Ga0466710_160894 | 3300042613 | Bacteria | 65837 |
| 173 | Ga0466711_372501 | 3300042615 | Bacteria | 489210 |
| 174 | Ga0466715_290760 | 3300042616 | Unclassified | 6833 |
| 175 | Ga0466718_099286 | 3300042617 | Bacteria | 55709 |
| 176 | Ga0466723_076997 | 3300042618 | Unclassified | 48254 |
| 177 | Ga0466723_133842 | 3300042618 | Bacteria | 68745 |
| 178 | Ga0466723_188730 | 3300042618 | Bacteria | 32869 |
| 179 | Ga0466707_225942 | 3300042601 | Unclassified | 1928 |
| 180 | Ga0466713_134711 | 3300042602 | Bacteria | 7763 |
| 181 | Ga0466719_524336 | 3300042606 | Bacteria | 382683 |
| 182 | Ga0466722_200602 | 3300042609 | Unclassified | 2211 |
| 183 | Ga0562376_4618 | 3300056857 | Unclassified | 10930 |
| 184 | Ga0466704_451294 | 3300042643 | Bacteria | 17773 |
| 185 | JGI24702J35022_10000284 | 3300002462 | Bacteria | 29622 |
| 186 | Ga0068302_10016466 | 3300005071 | Unclassified | 4359 |
| 187 | Ga0123355_10381969 | 3300009826 | Bacteria | 1834 |
| 188 | Ga0466692_090915 | 3300042591 | Bacteria | 14334 |
| 189 | Ga0466711_242327 | 3300042615 | Bacteria | 45441 |
| 190 | Ga0466723_022972 | 3300042618 | Bacteria | 101765 |
| 191 | Ga0466723_145616 | 3300042618 | Bacteria | 21579 |
| 192 | Ga0466723_340534 | 3300042618 | Bacteria | 22927 |
| 193 | Ga0466700_090530 | 3300042600 | Bacteria | 1581 |
| 194 | Ga0466713_066472 | 3300042602 | Bacteria | 19181 |
| 195 | Ga0466713_143886 | 3300042602 | Bacteria | 2453 |
| 196 | Ga0466716_171503 | 3300042605 | Bacteria | 13588 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.