Protein Family IF02365

Metagenome Isolate
158 Members
56 Samples
132 Scaffolds
305.41 Avg Length

🧬 Representative Sequence

ID
3300009826|Ga0123355_10016108|Ga0123355_100161082
Length
363 aa
Sequence
LLYFLYSFVRLRLYHYLNNNANNTSKGGATKMTVLKTHNLTKRYGNKAAVDNVSLTVEQGDIFGLIGQNGAGKSTFMKMVVSMTTPDSGEVQLFGKSERAQLDAARKRMGAMIETPMLFNHLTAHQNLEYYRLQRGVVEKNRIDEVLKIVNLTDTGKKRFKNFSLGMKQRLGLAVSMLTHPDFLIFDEPTNGLDPTGIIEMRDIIKRLNNEGITILISSHILTELAQVANKYAIIHEGRLIKNLTQEQLNQECKRALAITVDDAAKAAVVIENTALEGSKTEGGAMARRDYKQVSDTEIRVYDYLEDPTEMNFRLVQAGVRVASITEVGDSLEDYYIKLIGEASISKNAATENPNGKRGASK*

πŸ“Š Sample Types

Isolate 16.5%
Metagenome 83.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 46.3%
Termitidae 42.6%
Kalotermitidae 5.6%
Passalidae 3.7%
Stratiomyidae 1.9%

🌳 Taxonomy

Archaea 0
Bacteria 150
Eukaryota 0
Viruses 0
Unclassified 8

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820880921 Unclassified Actinobacteria Lab288P1bin60 Isolate Unclassified
2 2820934415 Unclassified Actinobacteria Emb289P1bin68 Isolate Unclassified
3 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
4 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
5 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
6 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
7 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
8 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
9 2820626145 Unclassified Firmicutes Emb289P1bin123 Isolate Unclassified
10 2820698910 Unclassified Firmicutes Co191P1bin64 Isolate Unclassified
11 2820546020 Unclassified Firmicutes Lab288P1bin102 Isolate Unclassified
12 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
13 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
14 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
15 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
16 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
17 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
18 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
19 2820294436 Unclassified Firmicutes Th196P3bin104 Isolate Unclassified
20 2820342392 Unclassified Firmicutes Nt197P3bin64 Isolate Unclassified
21 8030343600 Proteiniborus sp. MB09-C3 Isolate Stratiomyidae
22 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
23 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
24 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
25 2820255904 Unclassified Firmicutes Th196P3bin48 Isolate Unclassified
26 2820319488 Unclassified Firmicutes Nt197P3bin88 Isolate Unclassified
27 2820472365 Unclassified Firmicutes Lab288P1bin87 Isolate Unclassified
28 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
29 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
30 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
31 2820244222 Unclassified Firmicutes Th196P3bin75 Isolate Unclassified
32 2820292184 Unclassified Firmicutes Th196P3bin109 Isolate Unclassified
33 2820318056 Unclassified Firmicutes Nt197P3bin94 Isolate Unclassified
34 2820600392 Unclassified Firmicutes Emb289P1bin52 Isolate Unclassified
35 2820663833 Unclassified Firmicutes Co191P3bin41 Isolate Unclassified
36 2820666966 Unclassified Firmicutes Co191P3bin39 Isolate Unclassified
37 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
38 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
39 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
40 2820329821 Unclassified Firmicutes Nt197P3bin77 Isolate Unclassified
41 2820513949 Unclassified Firmicutes Lab288P1bin39 Isolate Unclassified
42 2820627938 Unclassified Firmicutes Emb289P1bin122 Isolate Unclassified
43 2820389254 Unclassified Firmicutes Nc150P4bin19 Isolate Unclassified
44 2820488713 Unclassified Firmicutes Lab288P1bin69 Isolate Unclassified
45 2820512088 Unclassified Firmicutes Lab288P1bin4 Isolate Unclassified
46 2820623020 Unclassified Firmicutes Emb289P1bin126 Isolate Unclassified
47 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
48 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
49 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
50 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
51 2820871393 Unclassified Actinobacteria Lab288P3bin101 Isolate Unclassified
52 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
53 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
54 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
55 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
56 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123355_10000123 3300009826 Bacteria 89072
2 Ga0123355_10002982 3300009826 Bacteria 24068
3 Ga0123355_10024125 3300009826 Bacteria 9770
4 Ga0123355_10175319 3300009826 Bacteria 3195
5 Ga0123355_10267778 3300009826 Bacteria 2379
6 Ga0123353_10113025 3300010167 Bacteria 4371
7 Ga0123353_10126127 3300010167 Bacteria 4114
8 Ga0466657_053669 3300042582 Bacteria 6340
9 Ga0466694_285250 3300042594 Bacteria 4834
10 IMNBL1DRAFT_c0015420 3300000062 Bacteria 3317
11 JGI24703J35330_11628252 3300002501 Bacteria 1484
12 JGI24697J35500_11247309 3300002507 Bacteria 2403
13 Ga0072940_1071987 3300005200 Bacteria 9003
14 Ga0072940_1135204 3300005200 Bacteria 1341
15 Ga0072941_1584841 3300005201 Bacteria 3700
16 Ga0466700_116731 3300042600 Bacteria 2332
17 Ga0466700_170606 3300042600 Bacteria 1661
18 Ga0466714_029490 3300042603 Bacteria 3575
19 Ga0466719_142900 3300042606 Bacteria 5314
20 Ga0466715_027973 3300042616 Bacteria 6783
21 Ga0466708_440085 3300042652 Bacteria 8785
22 Ga0123355_10000100 3300009826 Bacteria 93872
23 Ga0123355_10000280 3300009826 Bacteria 65600
24 Ga0123355_10000300 3300009826 Bacteria 63291
25 Ga0123355_10003045 3300009826 Bacteria 23884
26 Ga0123355_10116959 3300009826 Bacteria 4147
27 Ga0123355_10478416 3300009826 Bacteria 1551
28 Ga0123355_10817617 3300009826 Bacteria 1034
29 Ga0123354_10319633 3300010882 Bacteria 1435
30 Ga0123354_10321712 3300010882 Bacteria 1426
31 Ga0466694_359341 3300042594 Bacteria 3582
32 2227641286 2225789004 Unclassified 11044
33 Ga0466700_385530 3300042600 Bacteria 1342
34 Ga0466717_216865 3300042604 Bacteria 3167
35 Ga0466734_153925 3300042623 Bacteria 3432
36 Ga0123355_10002446 3300009826 Bacteria 26241
37 Ga0123355_10009822 3300009826 Bacteria 14606
38 Ga0123355_10012328 3300009826 Bacteria 13240
39 Ga0123355_10032125 3300009826 Bacteria 8520
40 Ga0123355_10076673 3300009826 Bacteria 5345
41 Ga0123355_10212240 3300009826 Bacteria 2803
42 Ga0123355_10213597 3300009826 Bacteria 2790
43 Ga0123355_10492872 3300009826 Bacteria 1517
44 Ga0123353_10102518 3300010167 Bacteria 4612
45 Ga0123353_10237132 3300010167 Bacteria 2838
46 Ga0123353_10392944 3300010167 Bacteria 2068
47 Ga0123354_10122331 3300010882 Unclassified 3351
48 Ga0415639_067162 3300038395 Bacteria 4017
49 Ga0466693_013107 3300042592 Bacteria 2247
50 Ga0466693_126544 3300042592 Unclassified 1234
51 Ga0466694_369682 3300042594 Bacteria 3507
52 Ga0072941_1131713 3300005201 Bacteria 14134
53 Ga0466707_002511 3300042601 Bacteria 16530
54 Ga0466721_127400 3300042608 Bacteria 1127
55 Ga0123355_10000183 3300009826 Bacteria 77565
56 Ga0123355_10012887 3300009826 Bacteria 12979
57 Ga0123355_10189826 3300009826 Bacteria 3029
58 Ga0123355_10317072 3300009826 Bacteria 2105
59 Ga0123353_10494703 3300010167 Bacteria 1784
60 Ga0123353_10513582 3300010167 Bacteria 1741
61 Ga0123354_10307087 3300010882 Bacteria 1489
62 IMNBL1DRAFT_c0027657 3300000062 Bacteria 2128
63 AustNasuHG_c1000241 3300000089 Bacteria 18447
64 JGI24695J34938_10000578 3300002450 Bacteria 35355
65 Ga0466714_041534 3300042603 Bacteria 1606
66 Ga0466717_136738 3300042604 Bacteria 1019
67 Ga0466721_168089 3300042608 Bacteria 13534
68 Ga0466721_293073 3300042608 Bacteria 72782
69 Ga0466718_068212 3300042617 Bacteria 1989
70 Ga0466724_24600 3300042649 Bacteria 3796
71 Ga0466724_36181 3300042649 Bacteria 13928
72 Ga0466708_436921 3300042652 Bacteria 25427
73 Ga0123355_10009003 3300009826 Bacteria 15131
74 Ga0123355_10165821 3300009826 Bacteria 3315
75 Ga0123355_10191300 3300009826 Bacteria 3013
76 Ga0123355_10201086 3300009826 Bacteria 2910
77 Ga0123353_10106348 3300010167 Bacteria 4521
78 Ga0123353_10166907 3300010167 Bacteria 3499
79 Ga0123353_10237946 3300010167 Bacteria 2832
80 Ga0123353_10745367 3300010167 Bacteria 1364
81 Ga0466693_287406 3300042592 Bacteria 1506
82 2227582954 2225789004 Bacteria 13304
83 IMNBL1DRAFT_c0000152 3300000062 Bacteria 62047
84 Ga0466717_257874 3300042604 Bacteria 1574
85 Ga0466721_120073 3300042608 Bacteria 87856
86 Ga0123355_10001021 3300009826 Bacteria 38874
87 Ga0123355_10051495 3300009826 Unclassified 6682
88 Ga0123355_10066658 3300009826 Unclassified 5794
89 Ga0123355_10067815 3300009826 Bacteria 5740
90 Ga0123355_10144928 3300009826 Bacteria 3624
91 Ga0123355_10513386 3300009826 Bacteria 1471
92 Ga0123355_10738009 3300009826 Unclassified 1118
93 Ga0123353_10458259 3300010167 Unclassified 1874
94 Ga0123353_10601235 3300010167 Bacteria 1572
95 Ga0123354_10296525 3300010882 Bacteria 1538
96 JGI24695J34938_10000414 3300002450 Bacteria 41547
97 Ga0466700_002529 3300042600 Bacteria 2814
98 Ga0466714_080528 3300042603 Bacteria 1410
99 Ga0466721_224514 3300042608 Bacteria 9450
100 Ga0466698_485304 3300042610 Bacteria 37200
101 Ga0466734_037928 3300042623 Bacteria 8670
102 Ga0123355_10006559 3300009826 Bacteria 17267
103 Ga0123355_10016108 3300009826 Bacteria 11772
104 Ga0123355_10156471 3300009826 Bacteria 3446
105 Ga0123355_10159932 3300009826 Bacteria 3396
106 Ga0123355_10171941 3300009826 Bacteria 3235
107 Ga0123355_10341937 3300009826 Bacteria 1992
108 Ga0123356_10420042 3300010049 Bacteria 1479
109 Ga0123354_10169155 3300010882 Bacteria 2553
110 AustNasuHG_c1000161 3300000089 Bacteria 21420
111 Ga0466698_472644 3300042610 Bacteria 2045
112 Ga0466734_041477 3300042623 Bacteria 1106
113 Ga0466702_462108 3300042635 Bacteria 2835
114 Ga0466732_423043 3300042656 Bacteria 1635
115 Ga0123355_10000956 3300009826 Bacteria 39966
116 Ga0123355_10022736 3300009826 Bacteria 10054
117 Ga0123355_10039820 3300009826 Unclassified 7648
118 Ga0123355_10079578 3300009826 Bacteria 5234
119 Ga0123355_10098648 3300009826 Bacteria 4607
120 Ga0123355_10105962 3300009826 Bacteria 4410
121 Ga0123355_10134022 3300009826 Bacteria 3809
122 Ga0123353_10090567 3300010167 Bacteria 4926
123 Ga0123354_10209852 3300010882 Bacteria 2109
124 Ga0264413_113926 3300024493 Bacteria 4819
125 Ga0466693_415137 3300042592 Bacteria 1102
126 JGI24703J35330_11578640 3300002501 Bacteria 1303
127 Ga0072940_1071988 3300005200 Bacteria 13615
128 Ga0466714_086667 3300042603 Bacteria 3447
129 Ga0466717_283632 3300042604 Bacteria 3278
130 Ga0466721_048119 3300042608 Bacteria 1816
131 Ga0466734_056341 3300042623 Bacteria 2174
132 Ga0466702_247075 3300042635 Bacteria 5986

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00005 ABC_tran ABC transporter 51 191 0.98
PF13304 AAA_21 AAA domain, putative AbiEii toxin, Type IV TA system 138 223 0.82

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.