Protein Family IF02365
Metagenome
Isolate
158
Members
56
Samples
132
Scaffolds
305.41
Avg Length
Representative Sequence
- ID
- 3300009826|Ga0123355_10016108|Ga0123355_100161082
- Length
- 363 aa
- Sequence
- LLYFLYSFVRLRLYHYLNNNANNTSKGGATKMTVLKTHNLTKRYGNKAAVDNVSLTVEQGDIFGLIGQNGAGKSTFMKMVVSMTTPDSGEVQLFGKSERAQLDAARKRMGAMIETPMLFNHLTAHQNLEYYRLQRGVVEKNRIDEVLKIVNLTDTGKKRFKNFSLGMKQRLGLAVSMLTHPDFLIFDEPTNGLDPTGIIEMRDIIKRLNNEGITILISSHILTELAQVANKYAIIHEGRLIKNLTQEQLNQECKRALAITVDDAAKAAVVIENTALEGSKTEGGAMARRDYKQVSDTEIRVYDYLEDPTEMNFRLVQAGVRVASITEVGDSLEDYYIKLIGEASISKNAATENPNGKRGASK*
Sample Types
Isolate
16.5%
Metagenome
83.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
46.3%
Termitidae
42.6%
Kalotermitidae
5.6%
Passalidae
3.7%
Stratiomyidae
1.9%
Taxonomy
Archaea
0
Bacteria
150
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820880921 | Unclassified Actinobacteria Lab288P1bin60 | Isolate | Unclassified |
| 2 | 2820934415 | Unclassified Actinobacteria Emb289P1bin68 | Isolate | Unclassified |
| 3 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 4 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 5 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 6 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 7 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 8 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 9 | 2820626145 | Unclassified Firmicutes Emb289P1bin123 | Isolate | Unclassified |
| 10 | 2820698910 | Unclassified Firmicutes Co191P1bin64 | Isolate | Unclassified |
| 11 | 2820546020 | Unclassified Firmicutes Lab288P1bin102 | Isolate | Unclassified |
| 12 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 13 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 14 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 15 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 16 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 17 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 18 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 19 | 2820294436 | Unclassified Firmicutes Th196P3bin104 | Isolate | Unclassified |
| 20 | 2820342392 | Unclassified Firmicutes Nt197P3bin64 | Isolate | Unclassified |
| 21 | 8030343600 | Proteiniborus sp. MB09-C3 | Isolate | Stratiomyidae |
| 22 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 23 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 24 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 25 | 2820255904 | Unclassified Firmicutes Th196P3bin48 | Isolate | Unclassified |
| 26 | 2820319488 | Unclassified Firmicutes Nt197P3bin88 | Isolate | Unclassified |
| 27 | 2820472365 | Unclassified Firmicutes Lab288P1bin87 | Isolate | Unclassified |
| 28 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 29 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 30 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 31 | 2820244222 | Unclassified Firmicutes Th196P3bin75 | Isolate | Unclassified |
| 32 | 2820292184 | Unclassified Firmicutes Th196P3bin109 | Isolate | Unclassified |
| 33 | 2820318056 | Unclassified Firmicutes Nt197P3bin94 | Isolate | Unclassified |
| 34 | 2820600392 | Unclassified Firmicutes Emb289P1bin52 | Isolate | Unclassified |
| 35 | 2820663833 | Unclassified Firmicutes Co191P3bin41 | Isolate | Unclassified |
| 36 | 2820666966 | Unclassified Firmicutes Co191P3bin39 | Isolate | Unclassified |
| 37 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 38 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 39 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 40 | 2820329821 | Unclassified Firmicutes Nt197P3bin77 | Isolate | Unclassified |
| 41 | 2820513949 | Unclassified Firmicutes Lab288P1bin39 | Isolate | Unclassified |
| 42 | 2820627938 | Unclassified Firmicutes Emb289P1bin122 | Isolate | Unclassified |
| 43 | 2820389254 | Unclassified Firmicutes Nc150P4bin19 | Isolate | Unclassified |
| 44 | 2820488713 | Unclassified Firmicutes Lab288P1bin69 | Isolate | Unclassified |
| 45 | 2820512088 | Unclassified Firmicutes Lab288P1bin4 | Isolate | Unclassified |
| 46 | 2820623020 | Unclassified Firmicutes Emb289P1bin126 | Isolate | Unclassified |
| 47 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 48 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 49 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 50 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 51 | 2820871393 | Unclassified Actinobacteria Lab288P3bin101 | Isolate | Unclassified |
| 52 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 53 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 54 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 55 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 56 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123355_10000123 | 3300009826 | Bacteria | 89072 |
| 2 | Ga0123355_10002982 | 3300009826 | Bacteria | 24068 |
| 3 | Ga0123355_10024125 | 3300009826 | Bacteria | 9770 |
| 4 | Ga0123355_10175319 | 3300009826 | Bacteria | 3195 |
| 5 | Ga0123355_10267778 | 3300009826 | Bacteria | 2379 |
| 6 | Ga0123353_10113025 | 3300010167 | Bacteria | 4371 |
| 7 | Ga0123353_10126127 | 3300010167 | Bacteria | 4114 |
| 8 | Ga0466657_053669 | 3300042582 | Bacteria | 6340 |
| 9 | Ga0466694_285250 | 3300042594 | Bacteria | 4834 |
| 10 | IMNBL1DRAFT_c0015420 | 3300000062 | Bacteria | 3317 |
| 11 | JGI24703J35330_11628252 | 3300002501 | Bacteria | 1484 |
| 12 | JGI24697J35500_11247309 | 3300002507 | Bacteria | 2403 |
| 13 | Ga0072940_1071987 | 3300005200 | Bacteria | 9003 |
| 14 | Ga0072940_1135204 | 3300005200 | Bacteria | 1341 |
| 15 | Ga0072941_1584841 | 3300005201 | Bacteria | 3700 |
| 16 | Ga0466700_116731 | 3300042600 | Bacteria | 2332 |
| 17 | Ga0466700_170606 | 3300042600 | Bacteria | 1661 |
| 18 | Ga0466714_029490 | 3300042603 | Bacteria | 3575 |
| 19 | Ga0466719_142900 | 3300042606 | Bacteria | 5314 |
| 20 | Ga0466715_027973 | 3300042616 | Bacteria | 6783 |
| 21 | Ga0466708_440085 | 3300042652 | Bacteria | 8785 |
| 22 | Ga0123355_10000100 | 3300009826 | Bacteria | 93872 |
| 23 | Ga0123355_10000280 | 3300009826 | Bacteria | 65600 |
| 24 | Ga0123355_10000300 | 3300009826 | Bacteria | 63291 |
| 25 | Ga0123355_10003045 | 3300009826 | Bacteria | 23884 |
| 26 | Ga0123355_10116959 | 3300009826 | Bacteria | 4147 |
| 27 | Ga0123355_10478416 | 3300009826 | Bacteria | 1551 |
| 28 | Ga0123355_10817617 | 3300009826 | Bacteria | 1034 |
| 29 | Ga0123354_10319633 | 3300010882 | Bacteria | 1435 |
| 30 | Ga0123354_10321712 | 3300010882 | Bacteria | 1426 |
| 31 | Ga0466694_359341 | 3300042594 | Bacteria | 3582 |
| 32 | 2227641286 | 2225789004 | Unclassified | 11044 |
| 33 | Ga0466700_385530 | 3300042600 | Bacteria | 1342 |
| 34 | Ga0466717_216865 | 3300042604 | Bacteria | 3167 |
| 35 | Ga0466734_153925 | 3300042623 | Bacteria | 3432 |
| 36 | Ga0123355_10002446 | 3300009826 | Bacteria | 26241 |
| 37 | Ga0123355_10009822 | 3300009826 | Bacteria | 14606 |
| 38 | Ga0123355_10012328 | 3300009826 | Bacteria | 13240 |
| 39 | Ga0123355_10032125 | 3300009826 | Bacteria | 8520 |
| 40 | Ga0123355_10076673 | 3300009826 | Bacteria | 5345 |
| 41 | Ga0123355_10212240 | 3300009826 | Bacteria | 2803 |
| 42 | Ga0123355_10213597 | 3300009826 | Bacteria | 2790 |
| 43 | Ga0123355_10492872 | 3300009826 | Bacteria | 1517 |
| 44 | Ga0123353_10102518 | 3300010167 | Bacteria | 4612 |
| 45 | Ga0123353_10237132 | 3300010167 | Bacteria | 2838 |
| 46 | Ga0123353_10392944 | 3300010167 | Bacteria | 2068 |
| 47 | Ga0123354_10122331 | 3300010882 | Unclassified | 3351 |
| 48 | Ga0415639_067162 | 3300038395 | Bacteria | 4017 |
| 49 | Ga0466693_013107 | 3300042592 | Bacteria | 2247 |
| 50 | Ga0466693_126544 | 3300042592 | Unclassified | 1234 |
| 51 | Ga0466694_369682 | 3300042594 | Bacteria | 3507 |
| 52 | Ga0072941_1131713 | 3300005201 | Bacteria | 14134 |
| 53 | Ga0466707_002511 | 3300042601 | Bacteria | 16530 |
| 54 | Ga0466721_127400 | 3300042608 | Bacteria | 1127 |
| 55 | Ga0123355_10000183 | 3300009826 | Bacteria | 77565 |
| 56 | Ga0123355_10012887 | 3300009826 | Bacteria | 12979 |
| 57 | Ga0123355_10189826 | 3300009826 | Bacteria | 3029 |
| 58 | Ga0123355_10317072 | 3300009826 | Bacteria | 2105 |
| 59 | Ga0123353_10494703 | 3300010167 | Bacteria | 1784 |
| 60 | Ga0123353_10513582 | 3300010167 | Bacteria | 1741 |
| 61 | Ga0123354_10307087 | 3300010882 | Bacteria | 1489 |
| 62 | IMNBL1DRAFT_c0027657 | 3300000062 | Bacteria | 2128 |
| 63 | AustNasuHG_c1000241 | 3300000089 | Bacteria | 18447 |
| 64 | JGI24695J34938_10000578 | 3300002450 | Bacteria | 35355 |
| 65 | Ga0466714_041534 | 3300042603 | Bacteria | 1606 |
| 66 | Ga0466717_136738 | 3300042604 | Bacteria | 1019 |
| 67 | Ga0466721_168089 | 3300042608 | Bacteria | 13534 |
| 68 | Ga0466721_293073 | 3300042608 | Bacteria | 72782 |
| 69 | Ga0466718_068212 | 3300042617 | Bacteria | 1989 |
| 70 | Ga0466724_24600 | 3300042649 | Bacteria | 3796 |
| 71 | Ga0466724_36181 | 3300042649 | Bacteria | 13928 |
| 72 | Ga0466708_436921 | 3300042652 | Bacteria | 25427 |
| 73 | Ga0123355_10009003 | 3300009826 | Bacteria | 15131 |
| 74 | Ga0123355_10165821 | 3300009826 | Bacteria | 3315 |
| 75 | Ga0123355_10191300 | 3300009826 | Bacteria | 3013 |
| 76 | Ga0123355_10201086 | 3300009826 | Bacteria | 2910 |
| 77 | Ga0123353_10106348 | 3300010167 | Bacteria | 4521 |
| 78 | Ga0123353_10166907 | 3300010167 | Bacteria | 3499 |
| 79 | Ga0123353_10237946 | 3300010167 | Bacteria | 2832 |
| 80 | Ga0123353_10745367 | 3300010167 | Bacteria | 1364 |
| 81 | Ga0466693_287406 | 3300042592 | Bacteria | 1506 |
| 82 | 2227582954 | 2225789004 | Bacteria | 13304 |
| 83 | IMNBL1DRAFT_c0000152 | 3300000062 | Bacteria | 62047 |
| 84 | Ga0466717_257874 | 3300042604 | Bacteria | 1574 |
| 85 | Ga0466721_120073 | 3300042608 | Bacteria | 87856 |
| 86 | Ga0123355_10001021 | 3300009826 | Bacteria | 38874 |
| 87 | Ga0123355_10051495 | 3300009826 | Unclassified | 6682 |
| 88 | Ga0123355_10066658 | 3300009826 | Unclassified | 5794 |
| 89 | Ga0123355_10067815 | 3300009826 | Bacteria | 5740 |
| 90 | Ga0123355_10144928 | 3300009826 | Bacteria | 3624 |
| 91 | Ga0123355_10513386 | 3300009826 | Bacteria | 1471 |
| 92 | Ga0123355_10738009 | 3300009826 | Unclassified | 1118 |
| 93 | Ga0123353_10458259 | 3300010167 | Unclassified | 1874 |
| 94 | Ga0123353_10601235 | 3300010167 | Bacteria | 1572 |
| 95 | Ga0123354_10296525 | 3300010882 | Bacteria | 1538 |
| 96 | JGI24695J34938_10000414 | 3300002450 | Bacteria | 41547 |
| 97 | Ga0466700_002529 | 3300042600 | Bacteria | 2814 |
| 98 | Ga0466714_080528 | 3300042603 | Bacteria | 1410 |
| 99 | Ga0466721_224514 | 3300042608 | Bacteria | 9450 |
| 100 | Ga0466698_485304 | 3300042610 | Bacteria | 37200 |
| 101 | Ga0466734_037928 | 3300042623 | Bacteria | 8670 |
| 102 | Ga0123355_10006559 | 3300009826 | Bacteria | 17267 |
| 103 | Ga0123355_10016108 | 3300009826 | Bacteria | 11772 |
| 104 | Ga0123355_10156471 | 3300009826 | Bacteria | 3446 |
| 105 | Ga0123355_10159932 | 3300009826 | Bacteria | 3396 |
| 106 | Ga0123355_10171941 | 3300009826 | Bacteria | 3235 |
| 107 | Ga0123355_10341937 | 3300009826 | Bacteria | 1992 |
| 108 | Ga0123356_10420042 | 3300010049 | Bacteria | 1479 |
| 109 | Ga0123354_10169155 | 3300010882 | Bacteria | 2553 |
| 110 | AustNasuHG_c1000161 | 3300000089 | Bacteria | 21420 |
| 111 | Ga0466698_472644 | 3300042610 | Bacteria | 2045 |
| 112 | Ga0466734_041477 | 3300042623 | Bacteria | 1106 |
| 113 | Ga0466702_462108 | 3300042635 | Bacteria | 2835 |
| 114 | Ga0466732_423043 | 3300042656 | Bacteria | 1635 |
| 115 | Ga0123355_10000956 | 3300009826 | Bacteria | 39966 |
| 116 | Ga0123355_10022736 | 3300009826 | Bacteria | 10054 |
| 117 | Ga0123355_10039820 | 3300009826 | Unclassified | 7648 |
| 118 | Ga0123355_10079578 | 3300009826 | Bacteria | 5234 |
| 119 | Ga0123355_10098648 | 3300009826 | Bacteria | 4607 |
| 120 | Ga0123355_10105962 | 3300009826 | Bacteria | 4410 |
| 121 | Ga0123355_10134022 | 3300009826 | Bacteria | 3809 |
| 122 | Ga0123353_10090567 | 3300010167 | Bacteria | 4926 |
| 123 | Ga0123354_10209852 | 3300010882 | Bacteria | 2109 |
| 124 | Ga0264413_113926 | 3300024493 | Bacteria | 4819 |
| 125 | Ga0466693_415137 | 3300042592 | Bacteria | 1102 |
| 126 | JGI24703J35330_11578640 | 3300002501 | Bacteria | 1303 |
| 127 | Ga0072940_1071988 | 3300005200 | Bacteria | 13615 |
| 128 | Ga0466714_086667 | 3300042603 | Bacteria | 3447 |
| 129 | Ga0466717_283632 | 3300042604 | Bacteria | 3278 |
| 130 | Ga0466721_048119 | 3300042608 | Bacteria | 1816 |
| 131 | Ga0466734_056341 | 3300042623 | Bacteria | 2174 |
| 132 | Ga0466702_247075 | 3300042635 | Bacteria | 5986 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.