Protein Family IF02297
Metagenome
Isolate
147
Members
54
Samples
112
Scaffolds
178.53
Avg Length
Representative Sequence
- ID
- 3300009826|Ga0123355_10000653|Ga0123355_1000065332
- Length
- 210 aa
- Sequence
- MYVPHSVALMRKIAKVDEKRNISHYEMKRRCIMAWNTRGLRGSLFEELIDLTNQLYRQKGLALIQKVPTPITPTAVDNKARTITQAYFEKKSTVDFIGAAQGLPLCFDAKETQQLNLPLRNIHDHQVEFMEDFKRQGGVAFLLVHFRTKGEMFLLPVETLSEAKTREKNGARKSIPYADFDRSLLVHNRGGFAVHYLEAVNAYLAAGMG*
Sample Types
Isolate
23.8%
Metagenome
76.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
63.0%
Termitidae
27.8%
Kalotermitidae
3.7%
Rhinotermitidae
1.9%
Hodotermitidae
1.9%
Termopsidae
1.9%
Taxonomy
Archaea
0
Bacteria
145
Eukaryota
0
Viruses
0
Unclassified
2
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820490862 | Unclassified Firmicutes Lab288P1bin64 | Isolate | Unclassified |
| 2 | 2820685979 | Unclassified Firmicutes Co191P1bin81 | Isolate | Unclassified |
| 3 | 2820696217 | Unclassified Firmicutes Co191P1bin66 | Isolate | Unclassified |
| 4 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 5 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 6 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 7 | 2820385248 | Unclassified Firmicutes Nt197P1bin19 | Isolate | Unclassified |
| 8 | 2820431532 | Unclassified Firmicutes Lab288P3bin230 | Isolate | Unclassified |
| 9 | 2820479655 | Unclassified Firmicutes Lab288P1bin77 | Isolate | Unclassified |
| 10 | 2820487239 | Unclassified Firmicutes Lab288P1bin71 | Isolate | Unclassified |
| 11 | 2820636287 | Unclassified Firmicutes Emb289P1bin112 | Isolate | Unclassified |
| 12 | 2820673891 | Unclassified Firmicutes Co191P3bin18 | Isolate | Unclassified |
| 13 | 2820676843 | Unclassified Firmicutes Co191P3bin17 | Isolate | Unclassified |
| 14 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 15 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 16 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 17 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 18 | 2820499546 | Unclassified Firmicutes Lab288P1bin54 | Isolate | Unclassified |
| 19 | 2820522177 | Unclassified Firmicutes Lab288P1bin22 | Isolate | Unclassified |
| 20 | 2820541116 | Unclassified Firmicutes Lab288P1bin109 | Isolate | Unclassified |
| 21 | 2820596822 | Unclassified Firmicutes Emb289P1bin58 | Isolate | Unclassified |
| 22 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 23 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 24 | 2820285501 | Unclassified Firmicutes Th196P3bin142 | Isolate | Unclassified |
| 25 | 2820435670 | Unclassified Firmicutes Lab288P3bin217 | Isolate | Unclassified |
| 26 | 2820698910 | Unclassified Firmicutes Co191P1bin64 | Isolate | Unclassified |
| 27 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 28 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 29 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 30 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 31 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 32 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 33 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 34 | 2820401926 | Unclassified Firmicutes Mp193P1bin2 | Isolate | Unclassified |
| 35 | 2820528380 | Unclassified Firmicutes Lab288P1bin143 | Isolate | Unclassified |
| 36 | 2820627938 | Unclassified Firmicutes Emb289P1bin122 | Isolate | Unclassified |
| 37 | 2820681712 | Unclassified Firmicutes Co191P1bin84 | Isolate | Unclassified |
| 38 | 2820693137 | Unclassified Firmicutes Co191P1bin70 | Isolate | Unclassified |
| 39 | 2820309449 | Unclassified Firmicutes Th196P1bin10 | Isolate | Unclassified |
| 40 | 2820380671 | Unclassified Firmicutes Nt197P1bin4 | Isolate | Unclassified |
| 41 | 2820432912 | Unclassified Firmicutes Lab288P3bin219 | Isolate | Unclassified |
| 42 | 2820530790 | Unclassified Firmicutes Lab288P1bin141 | Isolate | Unclassified |
| 43 | 2820547636 | Unclassified Firmicutes Lab288P1bin10 | Isolate | Unclassified |
| 44 | 2820598593 | Unclassified Firmicutes Emb289P1bin53 | Isolate | Unclassified |
| 45 | 2820607737 | Unclassified Firmicutes Emb289P1bin48 | Isolate | Unclassified |
| 46 | 2820663833 | Unclassified Firmicutes Co191P3bin41 | Isolate | Unclassified |
| 47 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 48 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 49 | 2820375548 | Unclassified Firmicutes Nt197P1bin8 | Isolate | Unclassified |
| 50 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 51 | 2820592308 | Unclassified Firmicutes Emb289P1bin71 | Isolate | Unclassified |
| 52 | 2820619171 | Unclassified Firmicutes Emb289P1bin130 | Isolate | Unclassified |
| 53 | 2820630457 | Unclassified Firmicutes Emb289P1bin119 | Isolate | Unclassified |
| 54 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_154586 | 3300042659 | Bacteria | 13215 |
| 2 | Ga0123355_10000412 | 3300009826 | Bacteria | 55560 |
| 3 | Ga0123355_10016399 | 3300009826 | Bacteria | 11676 |
| 4 | Ga0123355_10055917 | 3300009826 | Bacteria | 6389 |
| 5 | Ga0123355_10077012 | 3300009826 | Bacteria | 5332 |
| 6 | Ga0123355_10173435 | 3300009826 | Bacteria | 3217 |
| 7 | Ga0123355_10200179 | 3300009826 | Bacteria | 2920 |
| 8 | Ga0123355_10347041 | 3300009826 | Bacteria | 1971 |
| 9 | Ga0123355_10451084 | 3300009826 | Bacteria | 1621 |
| 10 | Ga0123355_10693452 | 3300009826 | Bacteria | 1172 |
| 11 | Ga0123355_10874970 | 3300009826 | Bacteria | 982 |
| 12 | JGI24703J35330_11748183 | 3300002501 | Bacteria | 11621 |
| 13 | Ga0466725_430151 | 3300042654 | Bacteria | 1533 |
| 14 | Ga0123355_10000460 | 3300009826 | Bacteria | 53629 |
| 15 | Ga0123355_10004344 | 3300009826 | Bacteria | 20618 |
| 16 | Ga0123355_10332637 | 3300009826 | Bacteria | 2033 |
| 17 | Ga0123355_10473284 | 3300009826 | Bacteria | 1564 |
| 18 | Ga0123355_10650610 | 3300009826 | Bacteria | 1230 |
| 19 | Ga0123353_10122070 | 3300010167 | Bacteria | 4188 |
| 20 | Ga0123353_11370293 | 3300010167 | Bacteria | 912 |
| 21 | Ga0466693_272692 | 3300042592 | Bacteria | 1527 |
| 22 | JGI24703J35330_11694094 | 3300002501 | Bacteria | 1941 |
| 23 | JGI24700J35501_10925355 | 3300002508 | Bacteria | 5783 |
| 24 | Ga0466725_353067 | 3300042654 | Bacteria | 18839 |
| 25 | Ga0466715_155513 | 3300042616 | Bacteria | 7251 |
| 26 | Ga0123355_10000089 | 3300009826 | Bacteria | 96529 |
| 27 | Ga0123355_10000706 | 3300009826 | Bacteria | 45274 |
| 28 | Ga0123355_10021341 | 3300009826 | Bacteria | 10362 |
| 29 | Ga0123355_10024263 | 3300009826 | Bacteria | 9748 |
| 30 | Ga0123355_10124471 | 3300009826 | Bacteria | 3988 |
| 31 | Ga0123355_10210979 | 3300009826 | Bacteria | 2814 |
| 32 | Ga0123355_10345501 | 3300009826 | Bacteria | 1977 |
| 33 | Ga0123355_10357291 | 3300009826 | Bacteria | 1928 |
| 34 | Ga0123355_10567766 | 3300009826 | Bacteria | 1363 |
| 35 | Ga0466700_213204 | 3300042600 | Bacteria | 4480 |
| 36 | JGI24695J34938_10000615 | 3300002450 | Bacteria | 33930 |
| 37 | JGI24695J34938_10052305 | 3300002450 | Bacteria | 1782 |
| 38 | Ga0466725_340747 | 3300042654 | Bacteria | 4056 |
| 39 | Ga0466711_121813 | 3300042615 | Bacteria | 4491 |
| 40 | Ga0123355_10001262 | 3300009826 | Bacteria | 35349 |
| 41 | Ga0123355_10024679 | 3300009826 | Bacteria | 9666 |
| 42 | Ga0123355_10083279 | 3300009826 | Bacteria | 5099 |
| 43 | Ga0123355_10302737 | 3300009826 | Bacteria | 2177 |
| 44 | Ga0123355_10419171 | 3300009826 | Bacteria | 1712 |
| 45 | Ga0123355_10545406 | 3300009826 | Bacteria | 1405 |
| 46 | Ga0123356_10898195 | 3300010049 | Bacteria | 1057 |
| 47 | Ga0123356_12674300 | 3300010049 | Unclassified | 625 |
| 48 | Ga0415639_032364 | 3300038395 | Bacteria | 10169 |
| 49 | Ga0466714_033941 | 3300042603 | Bacteria | 1987 |
| 50 | Ga0466714_159794 | 3300042603 | Bacteria | 1760 |
| 51 | JGI24703J35330_11741330 | 3300002501 | Bacteria | 3534 |
| 52 | Ga0466725_287531 | 3300042654 | Bacteria | 17176 |
| 53 | Ga0466733_213862 | 3300042659 | Bacteria | 4510 |
| 54 | Ga0123355_10000310 | 3300009826 | Bacteria | 62767 |
| 55 | Ga0123355_10000653 | 3300009826 | Bacteria | 47032 |
| 56 | Ga0123355_10037604 | 3300009826 | Bacteria | 7871 |
| 57 | Ga0123355_10230134 | 3300009826 | Bacteria | 2648 |
| 58 | Ga0123355_10528081 | 3300009826 | Bacteria | 1440 |
| 59 | Ga0123355_10800101 | 3300009826 | Bacteria | 1051 |
| 60 | Ga0123353_10000101 | 3300010167 | Bacteria | 99000 |
| 61 | Ga0415639_064160 | 3300038395 | Bacteria | 4689 |
| 62 | Ga0415639_127183 | 3300038395 | Bacteria | 2997 |
| 63 | Ga0466706_185155 | 3300042599 | Bacteria | 4036 |
| 64 | Ga0466722_243794 | 3300042609 | Bacteria | 4086 |
| 65 | Ga0466735_183220 | 3300042624 | Bacteria | 1094 |
| 66 | Ga0123355_10000685 | 3300009826 | Bacteria | 46071 |
| 67 | Ga0123355_10014612 | 3300009826 | Bacteria | 12291 |
| 68 | Ga0123355_10123765 | 3300009826 | Bacteria | 4004 |
| 69 | Ga0123355_10125768 | 3300009826 | Bacteria | 3962 |
| 70 | Ga0123355_10138679 | 3300009826 | Bacteria | 3729 |
| 71 | Ga0123355_10222521 | 3300009826 | Bacteria | 2711 |
| 72 | Ga0123355_10470201 | 3300009826 | Bacteria | 1571 |
| 73 | Ga0123355_10595639 | 3300009826 | Bacteria | 1314 |
| 74 | Ga0123355_10733113 | 3300009826 | Bacteria | 1123 |
| 75 | Ga0123355_10780763 | 3300009826 | Bacteria | 1071 |
| 76 | Ga0123355_10984594 | 3300009826 | Bacteria | 899 |
| 77 | Ga0123353_10145829 | 3300010167 | Bacteria | 3785 |
| 78 | Ga0123353_10784308 | 3300010167 | Bacteria | 1319 |
| 79 | Ga0415639_023111 | 3300038395 | Bacteria | 8745 |
| 80 | Ga0415639_032360 | 3300038395 | Bacteria | 19316 |
| 81 | Ga0415639_111594 | 3300038395 | Bacteria | 4494 |
| 82 | Ga0466714_028890 | 3300042603 | Bacteria | 2689 |
| 83 | JGI24695J34938_10000047 | 3300002450 | Bacteria | 91585 |
| 84 | JGI24695J34938_10000264 | 3300002450 | Bacteria | 50901 |
| 85 | JGI24703J35330_11748652 | 3300002501 | Bacteria | 23565 |
| 86 | Ga0123355_10003277 | 3300009826 | Bacteria | 23151 |
| 87 | Ga0123355_10007956 | 3300009826 | Bacteria | 15975 |
| 88 | Ga0123355_10013099 | 3300009826 | Bacteria | 12880 |
| 89 | Ga0123355_10014676 | 3300009826 | Bacteria | 12265 |
| 90 | Ga0123355_10761257 | 3300009826 | Bacteria | 1092 |
| 91 | Ga0123355_10789085 | 3300009826 | Bacteria | 1062 |
| 92 | Ga0123355_10989691 | 3300009826 | Bacteria | 895 |
| 93 | Ga0123355_11117163 | 3300009826 | Bacteria | 817 |
| 94 | Ga0123356_11898430 | 3300010049 | Bacteria | 742 |
| 95 | Ga0123353_10098392 | 3300010167 | Bacteria | 4715 |
| 96 | Ga0415639_015124 | 3300038395 | Bacteria | 3543 |
| 97 | Ga0415639_016396 | 3300038395 | Bacteria | 21169 |
| 98 | Ga0415639_115792 | 3300038395 | Bacteria | 1120 |
| 99 | Ga0466714_030714 | 3300042603 | Bacteria | 7705 |
| 100 | Ga0466698_292691 | 3300042610 | Bacteria | 1356 |
| 101 | JGI24695J34938_10263447 | 3300002450 | Bacteria | 735 |
| 102 | JGI24703J35330_11570602 | 3300002501 | Unclassified | 1279 |
| 103 | Ga0123355_10006817 | 3300009826 | Bacteria | 16994 |
| 104 | Ga0123355_10677842 | 3300009826 | Bacteria | 1193 |
| 105 | Ga0123353_10000095 | 3300010167 | Bacteria | 101562 |
| 106 | Ga0123353_10073472 | 3300010167 | Bacteria | 5496 |
| 107 | Ga0415639_001285 | 3300038395 | Bacteria | 60999 |
| 108 | Ga0415639_098095 | 3300038395 | Bacteria | 5012 |
| 109 | Ga0466699_257218 | 3300042597 | Bacteria | 2862 |
| 110 | Ga0466714_169613 | 3300042603 | Bacteria | 13172 |
| 111 | JGI24697J35500_11274945 | 3300002507 | Bacteria | 16978 |
| 112 | Ga0466725_188101 | 3300042654 | Bacteria | 10379 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF03838 | RecU | Recombination protein U | 41 | 201 | 0.99 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF03838 | GO:0006281 | DNA repair | BP |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.