Protein Family IF02280

Metagenome Isolate
121 Members
59 Samples
83 Scaffolds
579.58 Avg Length

🧬 Representative Sequence

ID
3300009826|Ga0123355_10000147|Ga0123355_1000014739
Length
643 aa
Sequence
MPQDGTVISSLVHEISQQILGGRIDKITQPEPDEIVLSIRSQGANHKLLLTTQSTAPRLHFTQASKPSPMQAPMFCMVLRKHLSGGRIVDIRQPGFERIVEFHIDALNEMGDRAVKVLLIEIMGKHSNIILVSPGTGEEPVTEAATFADDVLIAGNAPTFARVIDAIKHVPPSVSSVRAILPGSRYVPPPAGGKANPLDISEESFAQDLSNTTKNIQQALYQQYTGISPILASEICTRANIAPDTSIGSIGQTEIAQLYGAFLYVFDRVRAGDFAPHIYYSLDAQDTQMRENNLEISHIRQGKAVDITALPFVMYSHLHPQAYNSPSALQEAFYAKRDAGARVNQKTADLRKLVTTLQERCNKKAIVYEKTLADIKNRDDLRIKGELLTAYMHQVEQGTPSITLENFYDDNNPLEITIDPTLXXXENAQRYFKQYNKQKRTYTALQEQIAQNQEDQNYLDSVALAMETVTTEADIAEIRAELAEGGFVKRKYARLAAHTSKRDASHGKHKGSGQQSNKKGPAPSKPLHYTSTDGYDIYVGKNNTQNDHLTLRQAKNHDIWLHTKDIAGSHVIIITGGTQPPESTILEAANIAAYYSKGRNSSQVPVDYVQRKHVRKPNGAKPGFVIYDRHKTVYVSPKEPTA*

📊 Sample Types

Isolate 31.4%
Metagenome 68.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 52.5%
Termitidae 28.8%
Elmidae 5.1%
Kalotermitidae 3.4%
Apidae 3.4%
Rhinotermitidae 1.7%
Nephropidae 1.7%
Scarabaeidae 1.7%
Hodotermitidae 1.7%

🌳 Taxonomy

Archaea 0
Bacteria 115
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2864909992 Bacillus velezensis S00166 Isolate Elmidae
2 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
3 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
4 2820453354 Unclassified Firmicutes Lab288P3bin172 Isolate Unclassified
5 2820490862 Unclassified Firmicutes Lab288P1bin64 Isolate Unclassified
6 2820623020 Unclassified Firmicutes Emb289P1bin126 Isolate Unclassified
7 2820685979 Unclassified Firmicutes Co191P1bin81 Isolate Unclassified
8 2820696217 Unclassified Firmicutes Co191P1bin66 Isolate Unclassified
9 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
10 2820329821 Unclassified Firmicutes Nt197P3bin77 Isolate Unclassified
11 2820382897 Unclassified Firmicutes Nt197P1bin3 Isolate Unclassified
12 2820513949 Unclassified Firmicutes Lab288P1bin39 Isolate Unclassified
13 2820617402 Unclassified Firmicutes Emb289P1bin131 Isolate Unclassified
14 2820627938 Unclassified Firmicutes Emb289P1bin122 Isolate Unclassified
15 2820693137 Unclassified Firmicutes Co191P1bin70 Isolate Unclassified
16 2864801025 Bacillus aerius S00042 Isolate Elmidae
17 2820600392 Unclassified Firmicutes Emb289P1bin52 Isolate Unclassified
18 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
19 8043041867 Bacillus pumilus Ha06YP001 Isolate Nephropidae
20 2820479655 Unclassified Firmicutes Lab288P1bin77 Isolate Unclassified
21 2820673891 Unclassified Firmicutes Co191P3bin18 Isolate Unclassified
22 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
23 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
24 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
25 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
26 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
27 2864895409 Bacillus aerius S00152 Isolate Elmidae
28 2791355481 Bacillus sp. ZY-1-1 Isolate Scarabaeidae
29 2820303403 Unclassified Firmicutes Th196P1bin2 Isolate Unclassified
30 2820387566 Unclassified Firmicutes Nt197P1bin1 Isolate Unclassified
31 2820522177 Unclassified Firmicutes Lab288P1bin22 Isolate Unclassified
32 2820541116 Unclassified Firmicutes Lab288P1bin109 Isolate Unclassified
33 2820590132 Unclassified Firmicutes Emb289P1bin84 Isolate Unclassified
34 2820654856 Unclassified Firmicutes Cu122P1bin2 Isolate Unclassified
35 2820702360 Unclassified Firmicutes Co191P1bin4 Isolate Unclassified
36 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
37 2574180310 Bacillus licheniformis CG-B52 Isolate Unclassified
38 2820319488 Unclassified Firmicutes Nt197P3bin88 Isolate Unclassified
39 2820472365 Unclassified Firmicutes Lab288P1bin87 Isolate Unclassified
40 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
41 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
42 2827179085 Paenibacillus alvei DSM 29 Isolate Apidae
43 2209111004 Macrotermes natalensis queen gut microbiome Metagenome Termitidae
44 2820285501 Unclassified Firmicutes Th196P3bin142 Isolate Unclassified
45 2820435670 Unclassified Firmicutes Lab288P3bin217 Isolate Unclassified
46 2820602899 Unclassified Firmicutes Emb289P1bin51 Isolate Unclassified
47 2820698910 Unclassified Firmicutes Co191P1bin64 Isolate Unclassified
48 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
49 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
50 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
51 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
52 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
53 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
54 2820444930 Unclassified Firmicutes Lab288P3bin199 Isolate Unclassified
55 2820570671 Unclassified Firmicutes Emb289P3bin19 Isolate Unclassified
56 2820619171 Unclassified Firmicutes Emb289P1bin130 Isolate Unclassified
57 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
58 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
59 2971438493 Paenibacillus apiarius NRRL B-23460 Isolate Apidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123355_10000147 3300009826 Bacteria 84530
2 Ga0123355_10034188 3300009826 Bacteria 8259
3 Ga0123355_10080825 3300009826 Bacteria 5187
4 Ga0123355_10186617 3300009826 Bacteria 3065
5 Ga0415639_016435 3300038395 Bacteria 5430
6 JGI24695J34938_10006752 3300002450 Unclassified 6828
7 Ga0072940_1017039 3300005200 Bacteria 5829
8 Ga0466706_245792 3300042599 Bacteria 16334
9 Ga0466717_105115 3300042604 Unclassified 4957
10 Ga0123355_10033118 3300009826 Bacteria 8391
11 Ga0123356_10033640 3300010049 Bacteria 4794
12 Ga0123353_10083212 3300010167 Bacteria 5149
13 Ga0415639_100929 3300038395 Bacteria 10239
14 Ga0466715_247184 3300042616 Bacteria 6233
15 Ga0466714_046606 3300042603 Bacteria 3415
16 Ga0466719_164152 3300042606 Bacteria 5139
17 Ga0123355_10004185 3300009826 Bacteria 20957
18 Ga0123355_10004394 3300009826 Unclassified 20497
19 Ga0123355_10046873 3300009826 Bacteria 7028
20 Ga0123355_10120691 3300009826 Bacteria 4068
21 Ga0123355_10130476 3300009826 Bacteria 3873
22 Ga0123355_10302617 3300009826 Bacteria 2178
23 Ga0123353_10083669 3300010167 Bacteria 5135
24 Ga0123353_10224508 3300010167 Bacteria 2934
25 Ga0415639_024754 3300038395 Bacteria 6910
26 Ga0466693_380812 3300042592 Bacteria 2268
27 2212577974 2209111004 Bacteria 23753
28 JGI24695J34938_10001637 3300002450 Bacteria 18695
29 Ga0466721_108056 3300042608 Bacteria 144294
30 Ga0466698_165795 3300042610 Bacteria 5240
31 Ga0123355_10000961 3300009826 Bacteria 39860
32 Ga0123355_10002041 3300009826 Bacteria 28523
33 Ga0123355_10014812 3300009826 Bacteria 12213
34 Ga0123355_10015890 3300009826 Bacteria 11844
35 Ga0123355_10059918 3300009826 Bacteria 6148
36 Ga0123356_10000035 3300010049 Bacteria 145473
37 Ga0466714_068244 3300042603 Bacteria 3655
38 Ga0466714_068794 3300042603 Bacteria 2431
39 Ga0466714_135467 3300042603 Bacteria 23109
40 Ga0123355_10001571 3300009826 Bacteria 31886
41 Ga0123355_10001792 3300009826 Unclassified 30082
42 Ga0123355_10007190 3300009826 Bacteria 16632
43 Ga0123355_10025389 3300009826 Bacteria 9538
44 Ga0123355_10029195 3300009826 Bacteria 8925
45 Ga0123355_10046082 3300009826 Bacteria 7092
46 Ga0123355_10089513 3300009826 Bacteria 4885
47 Ga0123355_10143613 3300009826 Bacteria 3645
48 Ga0123355_10147256 3300009826 Bacteria 3587
49 Ga0123355_10246352 3300009826 Bacteria 2523
50 Ga0123353_10000037 3300010167 Bacteria 145591
51 Ga0415639_015615 3300038395 Bacteria 7022
52 JGI24702J35022_10004808 3300002462 Bacteria 7983
53 JGI24703J35330_11748315 3300002501 Bacteria 13770
54 Ga0466729_178750 3300042621 Bacteria 4750
55 Ga0123355_10000279 3300009826 Bacteria 65611
56 Ga0123355_10004246 3300009826 Bacteria 20824
57 Ga0123355_10005659 3300009826 Bacteria 18349
58 Ga0123355_10035376 3300009826 Bacteria 8117
59 Ga0123355_10083886 3300009826 Bacteria 5077
60 Ga0123355_10131605 3300009826 Bacteria 3853
61 Ga0123355_10181794 3300009826 Bacteria 3119
62 Ga0123355_10000172 3300009826 Unclassified 78957
63 Ga0123355_10002170 3300009826 Bacteria 27655
64 Ga0123355_10004294 3300009826 Bacteria 20718
65 Ga0123355_10006687 3300009826 Bacteria 17146
66 Ga0123355_10008974 3300009826 Bacteria 15152
67 Ga0123355_10014518 3300009826 Bacteria 12327
68 Ga0123355_10056210 3300009826 Bacteria 6370
69 Ga0123353_10001194 3300010167 Bacteria 31785
70 Ga0123353_10058203 3300010167 Bacteria 6192
71 Ga0466702_416723 3300042635 Bacteria 7985
72 Ga0415639_023011 3300038395 Bacteria 7396
73 Ga0415639_030518 3300038395 Bacteria 4742
74 Ga0415639_103189 3300038395 Bacteria 4953
75 Ga0466699_038637 3300042597 Bacteria 14240
76 JGI24695J34938_10000270 3300002450 Bacteria 50612
77 Ga0466700_214341 3300042600 Bacteria 2136
78 Ga0466714_093356 3300042603 Bacteria 2641
79 Ga0123355_10000389 3300009826 Bacteria 56882
80 Ga0415639_000903 3300038395 Bacteria 47895
81 Ga0415639_000904 3300038395 Bacteria 47446
82 Ga0415639_000974 3300038395 Bacteria 3678
83 JGI24703J35330_11748692 3300002501 Unclassified 25516

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042604 Ga0466717_105115 Ga0466717_105115_2972_4720 524
2 3300002450 JGI24695J34938_10006752 JGI24695J34938_100067524 541
3 3300038395 Ga0415639_100929 Ga0415639_100929_3941_5653 542
4 3300042592 Ga0466693_380812 Ga0466693_380812_527_2212 542
5 iso_pr_bacteria 2820702360 2820704253 547
6 3300005200 Ga0072940_1017039 Ga0072940_10170392 550
7 3300038395 Ga0415639_016435 Ga0415639_016435_101_1753 550
8 iso_pr_bacteria 2820382897 2820383460 554
9 3300002501 JGI24703J35330_11748315 JGI24703J35330_117483157 555
10 3300009826 Ga0123355_10246352 Ga0123355_102463522 555
11 3300038395 Ga0415639_000974 Ga0415639_000974_255_1922 555
12 3300009826 Ga0123355_10033118 Ga0123355_100331185 556
13 3300009826 Ga0123355_10120691 Ga0123355_101206915 556
14 iso_pr_bacteria 2820319488 2820319776 557
15 2209111004 2212577974 2212422453 559
16 3300009826 Ga0123355_10000389 Ga0123355_1000038946 559
17 3300009826 Ga0123355_10147256 Ga0123355_101472564 559
18 3300042610 Ga0466698_165795 Ga0466698_165795_814_2493 559
19 iso_pr_bacteria 2820285501 2820286074 560
20 iso_pr_bacteria 2820570671 2820571935 561
21 3300010049 Ga0123356_10000035 Ga0123356_1000003542 562
22 3300042616 Ga0466715_247184 Ga0466715_247184_3035_4774 563
23 3300042635 Ga0466702_416723 Ga0466702_416723_401_2098 565
24 3300009826 Ga0123355_10029195 Ga0123355_100291955 568
25 iso_pr_bacteria 2864909992 2864910744 568
26 3300042600 Ga0466700_214341 Ga0466700_214341_246_2000 569
27 iso_pr_bacteria 2864801025 2864802750 569
28 iso_pr_bacteria 2864895409 2864896759 569
29 iso_pr_bacteria 8043041867 8043043150 569
30 iso_pr_bacteria 2574180310 2576356508 570
31 iso_pr_bacteria 2791355481 2794423815 571
32 iso_pr_bacteria 2820698910 2820701439 571
33 3300002450 JGI24695J34938_10001637 JGI24695J34938_100016378 572
34 3300010167 Ga0123353_10083669 Ga0123353_100836695 572
35 3300038395 Ga0415639_103189 Ga0415639_103189_2153_3871 572
36 3300038395 Ga0415639_024754 Ga0415639_024754_3664_5385 573
37 3300009826 Ga0123355_10143613 Ga0123355_101436133 575
38 3300042621 Ga0466729_178750 Ga0466729_178750_1053_2780 575
39 iso_pr_bacteria 2820490862 2820491247 575
40 3300002501 JGI24703J35330_11748692 JGI24703J35330_117486922 576
41 3300010049 Ga0123356_10033640 Ga0123356_100336404 576
42 iso_pr_bacteria 2820696217 2820696696 576
43 3300002450 JGI24695J34938_10000270 JGI24695J34938_100002703 577
44 3300009826 Ga0123355_10001792 Ga0123355_100017923 577
45 3300009826 Ga0123355_10014518 Ga0123355_100145187 577
46 3300009826 Ga0123355_10083886 Ga0123355_100838862 577
47 iso_pr_bacteria 2820522177 2820524061 577
48 3300009826 Ga0123355_10181794 Ga0123355_101817941 578
49 3300042603 Ga0466714_068794 Ga0466714_068794_645_2417 578
50 3300042606 Ga0466719_164152 Ga0466719_164152_2030_3766 578
51 iso_pr_bacteria 2820303403 2820304659 578
52 iso_pr_bacteria 2820673891 2820676704 578
53 iso_pr_bacteria 2820685979 2820688704 578
54 3300038395 Ga0415639_000903 Ga0415639_000903_24926_26665 579
55 3300042603 Ga0466714_046606 Ga0466714_046606_699_2438 579
56 iso_pr_bacteria 2820600392 2820602075 579
57 3300009826 Ga0123355_10004185 Ga0123355_1000418511 580
58 3300042603 Ga0466714_093356 Ga0466714_093356_885_2627 580
59 iso_pr_bacteria 2820623020 2820623909 580
60 3300009826 Ga0123355_10000279 Ga0123355_1000027926 581
61 3300009826 Ga0123355_10046873 Ga0123355_100468733 581
62 3300010167 Ga0123353_10083212 Ga0123353_100832124 581
63 iso_pr_bacteria 2820387566 2820388459 581
64 3300009826 Ga0123355_10004246 Ga0123355_100042466 582
65 3300038395 Ga0415639_000904 Ga0415639_000904_24601_26349 582
66 iso_pr_bacteria 2820329821 2820330847 582
67 iso_pr_bacteria 2820444930 2820446343 582
68 iso_pr_bacteria 2820453354 2820454751 582
69 iso_pr_bacteria 2820654856 2820656141 582
70 iso_pr_bacteria 2820693137 2820694279 582
71 3300009826 Ga0123355_10004294 Ga0123355_1000429413 583
72 3300009826 Ga0123355_10005659 Ga0123355_100056599 583
73 3300009826 Ga0123355_10089513 Ga0123355_100895132 583
74 3300010167 Ga0123353_10001194 Ga0123353_100011946 583
75 3300010167 Ga0123353_10058203 Ga0123353_100582035 583
76 3300009826 Ga0123355_10002041 Ga0123355_100020414 584
77 3300009826 Ga0123355_10007190 Ga0123355_1000719010 584
78 3300009826 Ga0123355_10014812 Ga0123355_1001481213 584
79 3300009826 Ga0123355_10035376 Ga0123355_100353761 584
80 iso_pr_bacteria 2820619171 2820619410 584
81 3300002462 JGI24702J35022_10004808 JGI24702J35022_100048086 585
82 iso_pr_bacteria 2820479655 2820479842 585
83 3300009826 Ga0123355_10046082 Ga0123355_100460823 586
84 3300042603 Ga0466714_135467 Ga0466714_135467_17584_19344 586
85 3300038395 Ga0415639_015615 Ga0415639_015615_2026_3789 587
86 3300038395 Ga0415639_023011 Ga0415639_023011_2611_4374 587
87 3300038395 Ga0415639_030518 Ga0415639_030518_1533_3296 587
88 3300042603 Ga0466714_068244 Ga0466714_068244_1118_2884 588
89 iso_pr_bacteria 2820513949 2820515563 588
90 iso_pr_bacteria 2820627938 2820630056 588
91 iso_pr_bacteria 2820541116 2820543535 589
92 3300009826 Ga0123355_10025389 Ga0123355_100253892 590
93 3300010167 Ga0123353_10224508 Ga0123353_102245081 590
94 3300042608 Ga0466721_108056 Ga0466721_108056_118519_120294 591
95 3300009826 Ga0123355_10130476 Ga0123355_101304762 592
96 iso_pr_bacteria 2971438493 2971439819 592
97 3300009826 Ga0123355_10001571 Ga0123355_1000157110 593
98 3300009826 Ga0123355_10008974 Ga0123355_100089742 593
99 3300009826 Ga0123355_10080825 Ga0123355_100808257 593
100 iso_pr_bacteria 2820472365 2820473882 593
101 3300009826 Ga0123355_10302617 Ga0123355_103026172 594
102 3300009826 Ga0123355_10056210 Ga0123355_100562102 595
103 3300009826 Ga0123355_10186617 Ga0123355_101866172 595
104 3300042599 Ga0466706_245792 Ga0466706_245792_13182_14972 596
105 iso_pr_bacteria 2820435670 2820435804 596
106 iso_pr_bacteria 2820590132 2820590823 596
107 3300009826 Ga0123355_10004394 Ga0123355_1000439411 597
108 3300009826 Ga0123355_10015890 Ga0123355_100158906 597
109 3300010167 Ga0123353_10000037 Ga0123353_10000037131 597
110 3300042597 Ga0466699_038637 Ga0466699_038637_7742_9535 597
111 iso_pr_bacteria 2820602899 2820604658 597
112 3300009826 Ga0123355_10006687 Ga0123355_1000668712 598
113 3300009826 Ga0123355_10059918 Ga0123355_100599182 598
114 3300009826 Ga0123355_10131605 Ga0123355_101316053 602
115 iso_pr_bacteria 2827179085 2827183203 607
116 iso_pr_bacteria 2820617402 2820617826 611
117 3300009826 Ga0123355_10000172 Ga0123355_100001725 612
118 3300009826 Ga0123355_10000961 Ga0123355_100009613 613
119 3300009826 Ga0123355_10034188 Ga0123355_100341885 616
120 3300009826 Ga0123355_10002170 Ga0123355_1000217016 629
121 3300009826 Ga0123355_10000147 Ga0123355_1000014739 643

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF05833 NFACT_N NFACT N-terminal and middle domains 4 134 0.98
PF05670 NFACT-R_1 NFACT protein RNA binding domain 526 619 0.92
PF18297 NFACT-R_2 NFACT protein RNA binding domain 532 615 0.83

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.68 0.73 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.