Protein Family IF02272

Metagenome Isolate
131 Members
61 Samples
93 Scaffolds
753.4 Avg Length

🧬 Representative Sequence

ID
3300009826|Ga0123355_10000035|Ga0123355_1000003599
Length
814 aa
Sequence
MAEKTTRKDTVPQYMLDAFAAAGVRVDGLIYAIHTDMAADGDFADAYVAVDATNLYILYGEERVVKTEGARRIVAEYEIRELVTHPLLALSGLTTQTMLSTCRLINNPDKKADEENEGEKXXXXKPAGSSGRETLILLFSLGCQGFVDRLLKVIRNINKGDDPLQEIKEENPLFCPECGTRYPEPDRQLCPKCTDKMSIFMRLMGYFKYYKKQVALVSAGMLAVTVLSILAPYVGTRLLIDEVLTPPTRYYSAPSGEIISEHTRLLSAAPDYVYAYVETRGGQWYEMVGLIVLAIIAMRIVTTLFNIMQQYILSRTMPWMIYDLQMRIFEAMQRLSVSFYTSKRTGALMNRVSRDARNIYWFFVDGLPFIVINVILFIGIFGIMLWMDWRLALICITIIPFSAVMFRLLRSMFGRIWHKQWTINSQMNNMVSDAVNGQRVIKAFAREGEESRRFTDMGNKHAAVDVKGANLAWTAFPLIYLFMFIGQVAVTAYGGWMVIQGEITLGVLMAFLTYLGMLYGPLEFLSVVSNWWARCVDSAQRVFEVVDAKAEIEEPKNPVIIENMRGEIELDDVWFQYDPATPVLKGMTLHVPAGKTLGIVGKTGAGKSTMANLIARLYDTTEGVIKVDGINVRNMSLKQLRTSIGIVSQDIYLFIGSIVENIRYARPDATIEEVIWAAKMASAHDFITLLPDGYETRVGAGGQDLSGGEKQRLSIARTIIQNPKILILDEATAAMDTETEGKIQNALNELQSGRTTIAIAHRLSTLKDAENLAVIKDGKVVETGTHEELMRKKAEYHKLYSIQMEGLKVISME*

📊 Sample Types

Isolate 29.0%
Metagenome 71.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 63.3%
Termitidae 21.7%
Kalotermitidae 6.7%
Passalidae 3.3%
Rhinotermitidae 3.3%
Termopsidae 1.7%

🌳 Taxonomy

Archaea 0
Bacteria 127
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820267566 Unclassified Firmicutes Th196P3bin33 Isolate Unclassified
2 2820630457 Unclassified Firmicutes Emb289P1bin119 Isolate Unclassified
3 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
4 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
5 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
6 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
7 2820329821 Unclassified Firmicutes Nt197P3bin77 Isolate Unclassified
8 2820378768 Unclassified Firmicutes Nt197P1bin7 Isolate Unclassified
9 2820382897 Unclassified Firmicutes Nt197P1bin3 Isolate Unclassified
10 2820424542 Unclassified Firmicutes Lab288P3bin47 Isolate Unclassified
11 2820573558 Unclassified Firmicutes Emb289P3bin140 Isolate Unclassified
12 2820617402 Unclassified Firmicutes Emb289P1bin131 Isolate Unclassified
13 2820627938 Unclassified Firmicutes Emb289P1bin122 Isolate Unclassified
14 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
15 2820285501 Unclassified Firmicutes Th196P3bin142 Isolate Unclassified
16 2820405014 Unclassified Firmicutes Lab288P4bin88 Isolate Unclassified
17 2820435670 Unclassified Firmicutes Lab288P3bin217 Isolate Unclassified
18 2820698910 Unclassified Firmicutes Co191P1bin64 Isolate Unclassified
19 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
20 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
21 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
22 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
23 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
24 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
25 2820385248 Unclassified Firmicutes Nt197P1bin19 Isolate Unclassified
26 2820676843 Unclassified Firmicutes Co191P3bin17 Isolate Unclassified
27 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
28 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
29 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
30 2820265624 Unclassified Firmicutes Th196P3bin36 Isolate Unclassified
31 2820303403 Unclassified Firmicutes Th196P1bin2 Isolate Unclassified
32 2820332331 Unclassified Firmicutes Nt197P3bin75 Isolate Unclassified
33 2820342392 Unclassified Firmicutes Nt197P3bin64 Isolate Unclassified
34 2820522177 Unclassified Firmicutes Lab288P1bin22 Isolate Unclassified
35 2820541116 Unclassified Firmicutes Lab288P1bin109 Isolate Unclassified
36 2820596822 Unclassified Firmicutes Emb289P1bin58 Isolate Unclassified
37 2820644600 Unclassified Firmicutes Cu122P5bin39 Isolate Unclassified
38 2820702360 Unclassified Firmicutes Co191P1bin4 Isolate Unclassified
39 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
40 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
41 2820292184 Unclassified Firmicutes Th196P3bin109 Isolate Unclassified
42 2820380671 Unclassified Firmicutes Nt197P1bin4 Isolate Unclassified
43 2820432912 Unclassified Firmicutes Lab288P3bin219 Isolate Unclassified
44 2820530790 Unclassified Firmicutes Lab288P1bin141 Isolate Unclassified
45 2820566695 Unclassified Firmicutes Emb289P3bin50 Isolate Unclassified
46 2820600392 Unclassified Firmicutes Emb289P1bin52 Isolate Unclassified
47 2820607737 Unclassified Firmicutes Emb289P1bin48 Isolate Unclassified
48 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
49 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
50 2820375548 Unclassified Firmicutes Nt197P1bin8 Isolate Unclassified
51 2820408893 Unclassified Firmicutes Lab288P4bin80 Isolate Unclassified
52 2820615445 Unclassified Firmicutes Emb289P1bin132 Isolate Unclassified
53 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
54 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
55 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
56 2820582954 Unclassified Firmicutes Emb289P3bin119 Isolate Unclassified
57 2820623020 Unclassified Firmicutes Emb289P1bin126 Isolate Unclassified
58 2820685979 Unclassified Firmicutes Co191P1bin81 Isolate Unclassified
59 2820696217 Unclassified Firmicutes Co191P1bin66 Isolate Unclassified
60 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
61 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0415639_007632 3300038395 Bacteria 40242
2 Ga0415639_103229 3300038395 Bacteria 4582
3 Ga0466693_090916 3300042592 Bacteria 8480
4 Ga0123355_10000180 3300009826 Bacteria 77979
5 Ga0123355_10000311 3300009826 Bacteria 62673
6 Ga0123355_10000810 3300009826 Bacteria 42835
7 Ga0123355_10044374 3300009826 Unclassified 7238
8 Ga0123353_10005930 3300010167 Bacteria 16165
9 Ga0123353_10016165 3300010167 Bacteria 10892
10 Ga0072941_1257164 3300005201 Bacteria 6654
11 Ga0415639_037643 3300038395 Bacteria 9179
12 Ga0415639_058984 3300038395 Bacteria 5895
13 Ga0415639_088338 3300038395 Bacteria 4952
14 Ga0466704_079148 3300042643 Bacteria 6468
15 Ga0466725_206937 3300042654 Bacteria 4710
16 Ga0123355_10000062 3300009826 Bacteria 114407
17 Ga0123355_10000118 3300009826 Bacteria 90212
18 Ga0123355_10001753 3300009826 Bacteria 30327
19 Ga0123356_10025434 3300010049 Bacteria 5565
20 Ga0123353_10014634 3300010167 Bacteria 11324
21 Ga0123353_10024731 3300010167 Bacteria 9126
22 Ga0123353_10112149 3300010167 Bacteria 4391
23 Ga0123353_10116375 3300010167 Bacteria 4302
24 Ga0123354_10058332 3300010882 Bacteria 5737
25 JGI24698J34947_10001082 3300002449 Bacteria 14037
26 JGI24695J34938_10009860 3300002450 Bacteria 5278
27 JGI24703J35330_11748634 3300002501 Bacteria 22914
28 Ga0466721_043033 3300042608 Bacteria 5521
29 Ga0415639_001150 3300038395 Bacteria 31684
30 Ga0415639_046052 3300038395 Bacteria 14703
31 Ga0466692_158736 3300042591 Bacteria 36083
32 Ga0466727_176323 3300042655 Bacteria 3030
33 Ga0123355_10000034 3300009826 Bacteria 138123
34 Ga0123355_10000486 3300009826 Bacteria 52714
35 Ga0123355_10001945 3300009826 Bacteria 29124
36 Ga0123355_10016483 3300009826 Bacteria 11646
37 Ga0123355_10028809 3300009826 Bacteria 8982
38 Ga0123353_10000037 3300010167 Bacteria 145591
39 Ga0123353_10001271 3300010167 Bacteria 30913
40 JGI24703J35330_11748611 3300002501 Bacteria 22015
41 JGI24700J35501_10930583 3300002508 Bacteria 16187
42 Ga0466700_343883 3300042600 Bacteria 6831
43 Ga0466700_389641 3300042600 Bacteria 10295
44 Ga0415639_013760 3300038395 Bacteria 13189
45 Ga0466693_317432 3300042592 Bacteria 5844
46 Ga0123355_10002208 3300009826 Bacteria 27480
47 Ga0123355_10021157 3300009826 Bacteria 10408
48 Ga0123355_10028385 3300009826 Bacteria 9048
49 Ga0123355_10034260 3300009826 Bacteria 8250
50 Ga0123355_10077654 3300009826 Bacteria 5308
51 Ga0123356_10001271 3300010049 Bacteria 27891
52 Ga0415639_002310 3300038395 Bacteria 154573
53 Ga0415639_087647 3300038395 Unclassified 6633
54 Ga0466693_411070 3300042592 Bacteria 3780
55 Ga0466715_032155 3300042616 Bacteria 207155
56 Ga0123355_10008263 3300009826 Bacteria 15724
57 Ga0123353_10174159 3300010167 Bacteria 3413
58 IMNBL1DRAFT_c0001461 3300000062 Bacteria 17666
59 JGI24695J34938_10000024 3300002450 Bacteria 109661
60 Ga0415639_001085 3300038395 Bacteria 60940
61 Ga0466693_404092 3300042592 Bacteria 6940
62 Ga0123355_10000463 3300009826 Bacteria 53565
63 Ga0123355_10001566 3300009826 Bacteria 31924
64 Ga0123355_10030958 3300009826 Bacteria 8679
65 Ga0123355_10040498 3300009826 Bacteria 7583
66 Ga0123355_10192308 3300009826 Bacteria 3002
67 Ga0123356_10001598 3300010049 Bacteria 24871
68 Ga0415639_009825 3300038395 Bacteria 17478
69 Ga0466715_317474 3300042616 Bacteria 28415
70 Ga0123355_10001661 3300009826 Bacteria 30966
71 Ga0123355_10006689 3300009826 Bacteria 17143
72 Ga0123355_10075887 3300009826 Bacteria 5378
73 Ga0123356_10035665 3300010049 Unclassified 4645
74 Ga0123353_10045730 3300010167 Bacteria 6950
75 Ga0123353_10052026 3300010167 Bacteria 6538
76 Ga0123353_10152384 3300010167 Bacteria 3689
77 2227183584 2225789004 Bacteria 8026
78 IMNBL1DRAFT_c0000390 3300000062 Bacteria 37618
79 IMNBL1DRAFT_c0003821 3300000062 Bacteria 9387
80 JGI24698J34947_10004523 3300002449 Bacteria 7570
81 JGI24698J34947_10013398 3300002449 Bacteria 4478
82 JGI24695J34938_10001874 3300002450 Bacteria 17086
83 Ga0466719_104678 3300042606 Bacteria 18699
84 Ga0466721_216600 3300042608 Bacteria 10727
85 Ga0466722_096423 3300042609 Bacteria 7641
86 Ga0466696_317835 3300042596 Bacteria 25489
87 Ga0123355_10000035 3300009826 Bacteria 135705
88 Ga0123355_10000137 3300009826 Bacteria 86760
89 Ga0123355_10000442 3300009826 Bacteria 54682
90 Ga0123355_10002541 3300009826 Unclassified 25857
91 Ga0123355_10015824 3300009826 Bacteria 11867
92 Ga0123355_10043576 3300009826 Bacteria 7301
93 Ga0123354_10021327 3300010882 Bacteria 10206

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00664 ABC_membrane ABC transporter transmembrane region 287 522 0.97
PF00005 ABC_tran ABC transporter 584 733 0.93
PF02463 SMC_N RecF/RecN/SMC N terminal domain 615 776 0.9

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.