Protein Family IF02238
Metagenome
Isolate
151
Members
38
Samples
148
Scaffolds
397.4
Avg Length
Representative Sequence
- ID
- 3300009784|Ga0123357_10219322|Ga0123357_102193222
- Length
- 450 aa
- Sequence
- VKLAILGGSFNPVHIGHLFLADSVATGLGYDRVILVPAFQSPFKAGAEGASPQDRMEMLAASIAADPRLTIDDCEIRREGVSYTIDTLKDIIARYLPTGKPGLILGDDLASTFHNWRSPGEIAELAEIIIARRVLDTPLSPKGEGSEWNHGSPAGSPAGGDEYACKEDSRAREGPGTFPYPYRALDNEIINVSSRQVREKIGRFDAWRYLVPSGARNIIEDRGLYGFSGPGIRQSFRTGESVSGGESAPAVLFGDSRGLTETIVRLENDVRSILSPGRFMHSRNTALQVWDLCRRFGIDPQKGYLAGIAHDMCKSLGEKELFRLARADGGSISKLEQRKPGLLHARAAAVQLKRKYGIGDRDVLDAIRYHTTGTRDMNDLAKIVYIADKIEVGRPGIEASLRELKESADLETLFAAVLNNTVAFLRSRELDISYGTKRLLSAMHKRNSL*
Sample Types
Isolate
2.0%
Metagenome
98.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
36.8%
Termitidae
36.8%
Unclassified
15.8%
Rhinotermitidae
7.9%
Termopsidae
2.6%
Taxonomy
Archaea
0
Bacteria
147
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 2 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 3 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 4 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 5 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 6 | 2781125638 | Treponema sp. Co191P1bin8 | Isolate | Unclassified |
| 7 | 2781125652 | Treponema sp. Cu122P5bin1 | Isolate | Unclassified |
| 8 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 9 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 10 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 11 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 12 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 13 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 14 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 15 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 16 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 17 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 18 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 19 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 20 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 21 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 22 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 23 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 24 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 25 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 26 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 27 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 28 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 29 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 30 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 31 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 32 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 33 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 34 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 35 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 36 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 37 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 38 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_211043 | 3300042612 | Bacteria | 3138 |
| 2 | Ga0466707_016082 | 3300042601 | Bacteria | 1714 |
| 3 | Ga0466720_089281 | 3300042607 | Bacteria | 1699 |
| 4 | Ga0466712_050010 | 3300042614 | Bacteria | 6772 |
| 5 | Ga0466712_130896 | 3300042614 | Bacteria | 2807 |
| 6 | Ga0466723_068472 | 3300042618 | Bacteria | 6995 |
| 7 | Ga0466728_029165 | 3300042620 | Bacteria | 14439 |
| 8 | Ga0466728_270174 | 3300042620 | Bacteria | 3006 |
| 9 | Ga0466728_414620 | 3300042620 | Bacteria | 3600 |
| 10 | Ga0123353_10331386 | 3300010167 | Bacteria | 2304 |
| 11 | Ga0466694_245051 | 3300042594 | Bacteria | 1614 |
| 12 | Ga0466696_216510 | 3300042596 | Bacteria | 2299 |
| 13 | Ga0466696_265916 | 3300042596 | Bacteria | 7413 |
| 14 | Ga0466703_283225 | 3300042636 | Bacteria | 6229 |
| 15 | Ga0466703_422769 | 3300042636 | Bacteria | 16643 |
| 16 | Ga0466704_204218 | 3300042643 | Bacteria | 13888 |
| 17 | Ga0466704_504387 | 3300042643 | Bacteria | 19855 |
| 18 | Ga0466708_437332 | 3300042652 | Bacteria | 8785 |
| 19 | Ga0466705_101001 | 3300042612 | Bacteria | 2084 |
| 20 | Ga0466705_207149 | 3300042612 | Bacteria | 11213 |
| 21 | Ga0466707_164406 | 3300042601 | Bacteria | 2233 |
| 22 | Ga0466719_286417 | 3300042606 | Bacteria | 62956 |
| 23 | Ga0466719_541293 | 3300042606 | Bacteria | 5960 |
| 24 | Ga0466720_157778 | 3300042607 | Bacteria | 10739 |
| 25 | Ga0466715_065782 | 3300042616 | Bacteria | 6945 |
| 26 | Ga0466728_015487 | 3300042620 | Bacteria | 17071 |
| 27 | Ga0123357_10109183 | 3300009784 | Bacteria | 3535 |
| 28 | Ga0123355_10135464 | 3300009826 | Bacteria | 3784 |
| 29 | Ga0466690_005234 | 3300042590 | Bacteria | 9620 |
| 30 | Ga0466692_190614 | 3300042591 | Bacteria | 21035 |
| 31 | Ga0466699_056525 | 3300042597 | Unclassified | 2929 |
| 32 | Ga0466699_404426 | 3300042597 | Bacteria | 1763 |
| 33 | JGI24698J34947_10013389 | 3300002449 | Unclassified | 4479 |
| 34 | Ga0068305_10173101 | 3300005083 | Bacteria | 35194 |
| 35 | Ga0466709_066076 | 3300042648 | Bacteria | 20720 |
| 36 | Ga0466709_137960 | 3300042648 | Bacteria | 14959 |
| 37 | Ga0466709_269965 | 3300042648 | Bacteria | 2911 |
| 38 | Ga0466708_101893 | 3300042652 | Bacteria | 12133 |
| 39 | Ga0466719_225394 | 3300042606 | Bacteria | 70315 |
| 40 | Ga0466719_357995 | 3300042606 | Bacteria | 2120 |
| 41 | Ga0466719_419712 | 3300042606 | Bacteria | 3875 |
| 42 | Ga0466720_076308 | 3300042607 | Bacteria | 13359 |
| 43 | Ga0466711_053127 | 3300042615 | Bacteria | 43418 |
| 44 | Ga0466715_337854 | 3300042616 | Bacteria | 6518 |
| 45 | Ga0123357_10044679 | 3300009784 | Bacteria | 6014 |
| 46 | Ga0123353_10661388 | 3300010167 | Bacteria | 1476 |
| 47 | Ga0466691_130794 | 3300042593 | Bacteria | 27270 |
| 48 | Ga0466694_297967 | 3300042594 | Bacteria | 2175 |
| 49 | Ga0466699_117382 | 3300042597 | Bacteria | 7366 |
| 50 | Ga0466703_249883 | 3300042636 | Bacteria | 4505 |
| 51 | Ga0466703_416155 | 3300042636 | Bacteria | 14576 |
| 52 | Ga0466704_143666 | 3300042643 | Bacteria | 20926 |
| 53 | Ga0466704_411029 | 3300042643 | Bacteria | 56242 |
| 54 | Ga0466704_555238 | 3300042643 | Bacteria | 15816 |
| 55 | Ga0466708_177332 | 3300042652 | Bacteria | 7585 |
| 56 | Ga0466705_217785 | 3300042612 | Bacteria | 9980 |
| 57 | Ga0466713_107241 | 3300042602 | Bacteria | 3112 |
| 58 | Ga0466711_229884 | 3300042615 | Bacteria | 15610 |
| 59 | Ga0466711_289524 | 3300042615 | Bacteria | 53110 |
| 60 | Ga0466728_312536 | 3300042620 | Bacteria | 5478 |
| 61 | Ga0123353_10323100 | 3300010167 | Bacteria | 2341 |
| 62 | Ga0466690_353099 | 3300042590 | Bacteria | 4572 |
| 63 | Ga0466690_426217 | 3300042590 | Bacteria | 2113 |
| 64 | Ga0466691_137989 | 3300042593 | Bacteria | 6566 |
| 65 | Ga0466696_246247 | 3300042596 | Bacteria | 10396 |
| 66 | Ga0466696_371533 | 3300042596 | Bacteria | 2219 |
| 67 | Ga0466699_056422 | 3300042597 | Bacteria | 6374 |
| 68 | Ga0466703_020390 | 3300042636 | Bacteria | 20134 |
| 69 | Ga0466708_112988 | 3300042652 | Bacteria | 3130 |
| 70 | Ga0466708_236730 | 3300042652 | Bacteria | 12750 |
| 71 | Ga0466705_045890 | 3300042612 | Bacteria | 3772 |
| 72 | Ga0466705_128262 | 3300042612 | Bacteria | 15574 |
| 73 | Ga0466705_156372 | 3300042612 | Bacteria | 5377 |
| 74 | Ga0466732_253716 | 3300042656 | Bacteria | 3592 |
| 75 | Ga0466719_089683 | 3300042606 | Bacteria | 7170 |
| 76 | Ga0466711_250812 | 3300042615 | Bacteria | 11619 |
| 77 | Ga0466711_253954 | 3300042615 | Bacteria | 3775 |
| 78 | Ga0466715_333621 | 3300042616 | Bacteria | 6602 |
| 79 | Ga0466723_132263 | 3300042618 | Bacteria | 24648 |
| 80 | Ga0466728_032581 | 3300042620 | Bacteria | 5309 |
| 81 | Ga0466691_225301 | 3300042593 | Bacteria | 13445 |
| 82 | Ga0466694_015206 | 3300042594 | Bacteria | 16868 |
| 83 | Ga0466696_399139 | 3300042596 | Bacteria | 8907 |
| 84 | Ga0466699_441402 | 3300042597 | Bacteria | 1249 |
| 85 | JGI24702J35022_10069625 | 3300002462 | Bacteria | 1893 |
| 86 | Ga0466703_255570 | 3300042636 | Bacteria | 3368 |
| 87 | Ga0466704_235102 | 3300042643 | Bacteria | 10892 |
| 88 | Ga0466704_412182 | 3300042643 | Bacteria | 4622 |
| 89 | Ga0466708_109511 | 3300042652 | Bacteria | 32313 |
| 90 | Ga0466708_163864 | 3300042652 | Bacteria | 25092 |
| 91 | Ga0466708_318237 | 3300042652 | Bacteria | 2812 |
| 92 | Ga0466727_022593 | 3300042655 | Bacteria | 6490 |
| 93 | Ga0466727_257981 | 3300042655 | Bacteria | 1846 |
| 94 | Ga0466716_001080 | 3300042605 | Bacteria | 7359 |
| 95 | Ga0466716_496261 | 3300042605 | Bacteria | 1603 |
| 96 | Ga0466705_527441 | 3300042612 | Bacteria | 2255 |
| 97 | Ga0466715_092572 | 3300042616 | Bacteria | 11227 |
| 98 | Ga0466715_201361 | 3300042616 | Bacteria | 6489 |
| 99 | Ga0466715_306093 | 3300042616 | Unclassified | 3931 |
| 100 | Ga0466728_065455 | 3300042620 | Bacteria | 10146 |
| 101 | Ga0466728_396279 | 3300042620 | Bacteria | 2685 |
| 102 | Ga0466692_023781 | 3300042591 | Bacteria | 21532 |
| 103 | Ga0466692_066607 | 3300042591 | Bacteria | 1726 |
| 104 | Ga0466691_007663 | 3300042593 | Bacteria | 8719 |
| 105 | JGI24702J35022_10001485 | 3300002462 | Bacteria | 14553 |
| 106 | JGI24702J35022_10022030 | 3300002462 | Bacteria | 3453 |
| 107 | Ga0466703_132099 | 3300042636 | Bacteria | 29234 |
| 108 | Ga0466703_257353 | 3300042636 | Bacteria | 13035 |
| 109 | Ga0466705_176508 | 3300042612 | Bacteria | 9104 |
| 110 | Ga0466719_406469 | 3300042606 | Bacteria | 10049 |
| 111 | Ga0466705_405133 | 3300042612 | Bacteria | 2513 |
| 112 | Ga0466705_423543 | 3300042612 | Bacteria | 4670 |
| 113 | Ga0466723_012087 | 3300042618 | Bacteria | 2597 |
| 114 | Ga0466723_012293 | 3300042618 | Bacteria | 4804 |
| 115 | Ga0466723_088491 | 3300042618 | Bacteria | 13099 |
| 116 | Ga0466723_107104 | 3300042618 | Bacteria | 6262 |
| 117 | Ga0466728_412044 | 3300042620 | Bacteria | 2368 |
| 118 | Ga0466729_016682 | 3300042621 | Bacteria | 1643 |
| 119 | Ga0123356_10335483 | 3300010049 | Bacteria | 1630 |
| 120 | Ga0466691_119958 | 3300042593 | Bacteria | 6360 |
| 121 | Ga0466696_067834 | 3300042596 | Bacteria | 5394 |
| 122 | Ga0466699_035974 | 3300042597 | Bacteria | 2480 |
| 123 | Ga0466699_273395 | 3300042597 | Bacteria | 3320 |
| 124 | Ga0074263_100859 | 3300005485 | Bacteria | 1439 |
| 125 | Ga0466703_072751 | 3300042636 | Bacteria | 7973 |
| 126 | Ga0466704_564294 | 3300042643 | Bacteria | 10525 |
| 127 | Ga0466708_386703 | 3300042652 | Bacteria | 27535 |
| 128 | Ga0466705_054669 | 3300042612 | Bacteria | 14933 |
| 129 | Ga0466732_018499 | 3300042656 | Bacteria | 1732 |
| 130 | Ga0466722_136339 | 3300042609 | Bacteria | 31433 |
| 131 | Ga0466715_155138 | 3300042616 | Bacteria | 4187 |
| 132 | Ga0466723_025521 | 3300042618 | Unclassified | 2867 |
| 133 | Ga0466723_076357 | 3300042618 | Bacteria | 13425 |
| 134 | Ga0466723_132418 | 3300042618 | Bacteria | 6362 |
| 135 | Ga0466723_295027 | 3300042618 | Bacteria | 11999 |
| 136 | Ga0466723_369581 | 3300042618 | Bacteria | 64268 |
| 137 | Ga0123357_10219322 | 3300009784 | Bacteria | 2114 |
| 138 | Ga0415639_023283 | 3300038395 | Bacteria | 6428 |
| 139 | Ga0466691_061889 | 3300042593 | Bacteria | 7226 |
| 140 | Ga0466696_368836 | 3300042596 | Bacteria | 4158 |
| 141 | JGI24695J34938_10002475 | 3300002450 | Bacteria | 14085 |
| 142 | Ga0068305_10013479 | 3300005083 | Bacteria | 16490 |
| 143 | Ga0074263_105758 | 3300005485 | Bacteria | 1551 |
| 144 | Ga0466703_153577 | 3300042636 | Bacteria | 30864 |
| 145 | Ga0466704_002963 | 3300042643 | Bacteria | 15827 |
| 146 | Ga0466704_123376 | 3300042643 | Bacteria | 5853 |
| 147 | Ga0466704_569051 | 3300042643 | Bacteria | 1531 |
| 148 | Ga0466708_116392 | 3300042652 | Bacteria | 2812 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.