Protein Family IF02230
Metagenome
Isolate
128
Members
57
Samples
109
Scaffolds
192.65
Avg Length
Representative Sequence
- ID
- 3300009784|Ga0123357_10154279|Ga0123357_101542794
- Length
- 218 aa
- Sequence
- MKCTPPQATLQKILNSNNRIQGGDRVEFKDKKIGFALTGSFCTFETVIPYIKQLVEEGANVVPIMSFNAYNLNTRFGEAQYFIDQIEEITSNKIISTFVDAEPIGPKGLIDILIIAPCTGNTLAKLAQGISDTPVLLAAKSNLRNGNNVLIGISTNDGLSGNAENLGRLLNRKNYYFIPFQQDNPITKPRSLVFDSNYLIPALEKALENEQIQPILL*
Sample Types
Isolate
14.8%
Metagenome
85.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
36.8%
Unclassified
35.1%
Kalotermitidae
15.8%
Termopsidae
3.5%
Calliphoridae
1.8%
Hodotermitidae
1.8%
Scarabaeidae
1.8%
Rhinotermitidae
1.8%
Passalidae
1.8%
Taxonomy
Archaea
0
Bacteria
121
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820389254 | Unclassified Firmicutes Nc150P4bin19 | Isolate | Unclassified |
| 2 | 2820441105 | Unclassified Firmicutes Lab288P3bin202 | Isolate | Unclassified |
| 3 | 2820488713 | Unclassified Firmicutes Lab288P1bin69 | Isolate | Unclassified |
| 4 | 2820507989 | Unclassified Firmicutes Lab288P1bin41 | Isolate | Unclassified |
| 5 | 2820533259 | Unclassified Firmicutes Lab288P1bin140 | Isolate | Unclassified |
| 6 | 2820584674 | Unclassified Firmicutes Emb289P1bin98 | Isolate | Unclassified |
| 7 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 8 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 9 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 10 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 11 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 12 | 2852431164 | Brevibacillus laterosporus BON707 | Isolate | Calliphoridae |
| 13 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 14 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 15 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 16 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 17 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 18 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 19 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 20 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 21 | 2731957677 | Alkalihalobacillus trypoxylicola NBRC 102646 | Isolate | Scarabaeidae |
| 22 | 2820280018 | Unclassified Firmicutes Th196P3bin149 | Isolate | Unclassified |
| 23 | 2820406809 | Unclassified Firmicutes Lab288P4bin87 | Isolate | Unclassified |
| 24 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 25 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 26 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 27 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 28 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 29 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 30 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 31 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 32 | 2820252425 | Unclassified Firmicutes Th196P3bin6 | Isolate | Unclassified |
| 33 | 2820429680 | Unclassified Firmicutes Lab288P3bin30 | Isolate | Unclassified |
| 34 | 2820671341 | Unclassified Firmicutes Co191P3bin20 | Isolate | Unclassified |
| 35 | 2820688768 | Unclassified Firmicutes Co191P1bin74 | Isolate | Unclassified |
| 36 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 37 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 38 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 39 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 40 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 41 | 2820277137 | Unclassified Firmicutes Th196P3bin150 | Isolate | Unclassified |
| 42 | 2820576413 | Unclassified Firmicutes Emb289P3bin136 | Isolate | Unclassified |
| 43 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 44 | 2820570671 | Unclassified Firmicutes Emb289P3bin19 | Isolate | Unclassified |
| 45 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 46 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 47 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 48 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 49 | 2820250282 | Unclassified Firmicutes Th196P3bin66 | Isolate | Unclassified |
| 50 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 51 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 52 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 53 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 54 | 2820657860 | Unclassified Firmicutes Co191P4bin15 | Isolate | Unclassified |
| 55 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 56 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 57 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_377825 | 3300042612 | Bacteria | 346954 |
| 2 | Ga0466724_20248 | 3300042649 | Bacteria | 1880 |
| 3 | Ga0466723_190786 | 3300042618 | Bacteria | 19269 |
| 4 | Ga0123357_10311789 | 3300009784 | Bacteria | 1570 |
| 5 | Ga0123355_10077822 | 3300009826 | Bacteria | 5301 |
| 6 | Ga0123355_10349488 | 3300009826 | Bacteria | 1960 |
| 7 | Ga0123355_11025277 | 3300009826 | Bacteria | 872 |
| 8 | Ga0123356_10096068 | 3300010049 | Unclassified | 2833 |
| 9 | Ga0123356_10101937 | 3300010049 | Bacteria | 2755 |
| 10 | Ga0123353_10047556 | 3300010167 | Bacteria | 6825 |
| 11 | Ga0123353_10330768 | 3300010167 | Bacteria | 2306 |
| 12 | Ga0123353_11120095 | 3300010167 | Unclassified | 1043 |
| 13 | Ga0466714_098481 | 3300042603 | Bacteria | 5384 |
| 14 | Ga0466716_273502 | 3300042605 | Bacteria | 5622 |
| 15 | Ga0466722_038246 | 3300042609 | Bacteria | 1558 |
| 16 | Ga0072940_1573855 | 3300005200 | Bacteria | 3427 |
| 17 | Ga0466705_174190 | 3300042612 | Bacteria | 13575 |
| 18 | Ga0466733_036008 | 3300042659 | Bacteria | 2475 |
| 19 | Ga0466730_089158 | 3300042625 | Bacteria | 1360 |
| 20 | Ga0466704_019638 | 3300042643 | Bacteria | 9102 |
| 21 | Ga0466704_146814 | 3300042643 | Bacteria | 18797 |
| 22 | Ga0415639_060126 | 3300038395 | Bacteria | 1152 |
| 23 | Ga0123355_10135496 | 3300009826 | Bacteria | 3783 |
| 24 | Ga0123355_10378351 | 3300009826 | Bacteria | 1847 |
| 25 | Ga0123356_10000021 | 3300010049 | Bacteria | 176996 |
| 26 | Ga0123353_10008557 | 3300010167 | Bacteria | 13993 |
| 27 | Ga0123353_10091537 | 3300010167 | Bacteria | 4899 |
| 28 | Ga0123353_10594210 | 3300010167 | Bacteria | 1584 |
| 29 | Ga0123353_10640869 | 3300010167 | Bacteria | 1507 |
| 30 | Ga0123354_10000160 | 3300010882 | Bacteria | 53983 |
| 31 | Ga0466706_122870 | 3300042599 | Bacteria | 21375 |
| 32 | Ga0466707_245808 | 3300042601 | Bacteria | 3501 |
| 33 | Ga0466717_162301 | 3300042604 | Bacteria | 1414 |
| 34 | Ga0466727_128637 | 3300042655 | Bacteria | 6113 |
| 35 | Ga0466718_141082 | 3300042617 | Bacteria | 9960 |
| 36 | Ga0123355_10100790 | 3300009826 | Bacteria | 4547 |
| 37 | Ga0123355_10538945 | 3300009826 | Bacteria | 1417 |
| 38 | Ga0123356_10278301 | 3300010049 | Bacteria | 1767 |
| 39 | Ga0123356_11210912 | 3300010049 | Bacteria | 921 |
| 40 | Ga0123353_10185611 | 3300010167 | Bacteria | 3289 |
| 41 | Ga0123353_10858971 | 3300010167 | Bacteria | 1242 |
| 42 | Ga0466719_543086 | 3300042606 | Bacteria | 13409 |
| 43 | Ga0466698_420880 | 3300042610 | Bacteria | 8234 |
| 44 | 2227094433 | 2225789004 | Bacteria | 1820 |
| 45 | Ga0123355_10412899 | 3300009826 | Bacteria | 1731 |
| 46 | Ga0123356_11039781 | 3300010049 | Bacteria | 988 |
| 47 | Ga0123356_12016257 | 3300010049 | Bacteria | 720 |
| 48 | Ga0123353_10004613 | 3300010167 | Bacteria | 17783 |
| 49 | Ga0466706_159994 | 3300042599 | Bacteria | 17028 |
| 50 | Ga0466700_233069 | 3300042600 | Bacteria | 1121 |
| 51 | Ga0466713_135936 | 3300042602 | Bacteria | 11273 |
| 52 | JGI24696J40584_12955519 | 3300002834 | Bacteria | 2856 |
| 53 | Ga0123355_10000253 | 3300009826 | Bacteria | 68865 |
| 54 | Ga0123355_10049753 | 3300009826 | Bacteria | 6812 |
| 55 | Ga0123353_10000652 | 3300010167 | Bacteria | 42476 |
| 56 | Ga0123353_10001454 | 3300010167 | Bacteria | 28961 |
| 57 | Ga0123353_10423082 | 3300010167 | Bacteria | 1973 |
| 58 | Ga0466701_087365 | 3300042598 | Unclassified | 1839 |
| 59 | JGI24702J35022_10041400 | 3300002462 | Bacteria | 2456 |
| 60 | JGI24702J35022_10061603 | 3300002462 | Bacteria | 2008 |
| 61 | JGI24696J40584_12948640 | 3300002834 | Unclassified | 2017 |
| 62 | Ga0068305_10017054 | 3300005083 | Bacteria | 38460 |
| 63 | Ga0466733_158500 | 3300042659 | Bacteria | 12405 |
| 64 | Ga0466709_142702 | 3300042648 | Bacteria | 75830 |
| 65 | Ga0415639_000893 | 3300038395 | Bacteria | 4779 |
| 66 | Ga0466696_432165 | 3300042596 | Bacteria | 5432 |
| 67 | Ga0123355_10000409 | 3300009826 | Bacteria | 55870 |
| 68 | Ga0123355_10003561 | 3300009826 | Bacteria | 22385 |
| 69 | Ga0123355_10592351 | 3300009826 | Bacteria | 1320 |
| 70 | Ga0123355_10790867 | 3300009826 | Bacteria | 1061 |
| 71 | Ga0123356_10230718 | 3300010049 | Bacteria | 1915 |
| 72 | Ga0123353_10019460 | 3300010167 | Bacteria | 10089 |
| 73 | Ga0123353_10219090 | 3300010167 | Bacteria | 2978 |
| 74 | Ga0466706_281782 | 3300042599 | Bacteria | 1008 |
| 75 | Ga0466714_070350 | 3300042603 | Bacteria | 2317 |
| 76 | JGI24696J40584_12961167 | 3300002834 | Bacteria | 11537 |
| 77 | Ga0466703_361141 | 3300042636 | Bacteria | 14989 |
| 78 | Ga0466727_169982 | 3300042655 | Bacteria | 1132 |
| 79 | Ga0466718_015972 | 3300042617 | Bacteria | 1025 |
| 80 | Ga0123357_10154279 | 3300009784 | Bacteria | 2775 |
| 81 | Ga0123353_10000704 | 3300010167 | Bacteria | 40818 |
| 82 | Ga0466706_106113 | 3300042599 | Bacteria | 4941 |
| 83 | Ga0466706_216003 | 3300042599 | Bacteria | 119342 |
| 84 | JGI24695J34938_10003447 | 3300002450 | Unclassified | 11043 |
| 85 | JGI24705J35276_12217289 | 3300002504 | Bacteria | 2086 |
| 86 | Ga0072940_1220532 | 3300005200 | Bacteria | 1545 |
| 87 | Ga0466734_074641 | 3300042623 | Bacteria | 1065 |
| 88 | Ga0466705_388345 | 3300042612 | Bacteria | 17845 |
| 89 | Ga0466711_095138 | 3300042615 | Bacteria | 2816 |
| 90 | Ga0466726_446847 | 3300042619 | Bacteria | 2942 |
| 91 | Ga0415639_011871 | 3300038395 | Bacteria | 3635 |
| 92 | Ga0123355_10286139 | 3300009826 | Bacteria | 2268 |
| 93 | Ga0123355_10425558 | 3300009826 | Bacteria | 1693 |
| 94 | Ga0123356_10042698 | 3300010049 | Unclassified | 4222 |
| 95 | Ga0123356_10339607 | 3300010049 | Bacteria | 1622 |
| 96 | Ga0123356_10559555 | 3300010049 | Bacteria | 1305 |
| 97 | Ga0123356_10877956 | 3300010049 | Bacteria | 1068 |
| 98 | Ga0123356_11446344 | 3300010049 | Bacteria | 846 |
| 99 | Ga0123356_11639599 | 3300010049 | Bacteria | 797 |
| 100 | Ga0123353_10000375 | 3300010167 | Bacteria | 54692 |
| 101 | Ga0123353_10001012 | 3300010167 | Bacteria | 34361 |
| 102 | Ga0123353_10197697 | 3300010167 | Bacteria | 3167 |
| 103 | Ga0123353_10890245 | 3300010167 | Bacteria | 1213 |
| 104 | Ga0466706_194151 | 3300042599 | Bacteria | 9595 |
| 105 | Ga0466707_163801 | 3300042601 | Bacteria | 828024 |
| 106 | Ga0466707_197213 | 3300042601 | Bacteria | 46047 |
| 107 | Ga0466707_389617 | 3300042601 | Bacteria | 2213 |
| 108 | Ga0466714_070807 | 3300042603 | Bacteria | 3386 |
| 109 | JGI24702J35022_10027684 | 3300002462 | Unclassified | 3049 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02441 | Flavoprotein | Flavoprotein | 31 | 192 | 0.86 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02441 | GO:0003824 | catalytic activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.