Protein Family IF02210
Metagenome
Isolate
126
Members
37
Samples
122
Scaffolds
214.46
Avg Length
Representative Sequence
- ID
- 3300009784|Ga0123357_10069994|Ga0123357_100699942
- Length
- 252 aa
- Sequence
- MRILIVTPMKGKRTFMFFSLAASPYYNCTYFPNDIPSVGMGILANFVVFEGLDGSGTTTQLTILDDFFQRNPERLSLPPFYKTFEPTDGSIGRLIRSALRKETVYCPETVALLFAADRREHLYGAGGIAERCGRGELVVSDRYVPSSLVYQGITCGEELPAALNRDFPAPELLLFFDIDPETAQKRMAARNLKEIYEYLDFQIQVRRRYRELLPRFSTEGVRVEIIDASMPPEDVATEAWRAIQKMPIFKK*
Sample Types
Isolate
3.2%
Metagenome
96.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
37.8%
Termitidae
32.4%
Unclassified
13.5%
Termopsidae
8.1%
Rhinotermitidae
5.4%
Hodotermitidae
2.7%
Taxonomy
Archaea
0
Bacteria
123
Eukaryota
0
Viruses
0
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 2 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 3 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 11 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 12 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 13 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 14 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 15 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 16 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 17 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 18 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 19 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 20 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 21 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 22 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 23 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 24 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 25 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 26 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 27 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 28 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 29 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 30 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 31 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 32 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 33 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 34 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 35 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 36 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 37 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_101119 | 3300042659 | Bacteria | 4022 |
| 2 | Ga0466712_022893 | 3300042614 | Bacteria | 16595 |
| 3 | Ga0466711_243812 | 3300042615 | Bacteria | 1748 |
| 4 | Ga0466723_026938 | 3300042618 | Bacteria | 5476 |
| 5 | Ga0466703_080147 | 3300042636 | Bacteria | 13387 |
| 6 | Ga0466703_400973 | 3300042636 | Bacteria | 15271 |
| 7 | Ga0466704_254092 | 3300042643 | Bacteria | 3641 |
| 8 | Ga0466691_105933 | 3300042593 | Unclassified | 9504 |
| 9 | Ga0466696_264998 | 3300042596 | Bacteria | 25297 |
| 10 | Ga0466719_339448 | 3300042606 | Bacteria | 5971 |
| 11 | JGI24698J34947_10028936 | 3300002449 | Bacteria | 2932 |
| 12 | JGI24695J34938_10000180 | 3300002450 | Bacteria | 58816 |
| 13 | JGI24705J35276_12188291 | 3300002504 | Bacteria | 1439 |
| 14 | Ga0466705_045543 | 3300042612 | Bacteria | 1010 |
| 15 | Ga0466733_183013 | 3300042659 | Bacteria | 1816 |
| 16 | Ga0466712_155352 | 3300042614 | Bacteria | 28394 |
| 17 | Ga0466711_011072 | 3300042615 | Bacteria | 1968 |
| 18 | Ga0466715_025483 | 3300042616 | Bacteria | 12653 |
| 19 | Ga0466718_137791 | 3300042617 | Bacteria | 4476 |
| 20 | Ga0466723_099704 | 3300042618 | Bacteria | 4420 |
| 21 | Ga0466728_208062 | 3300042620 | Bacteria | 4629 |
| 22 | Ga0466728_363269 | 3300042620 | Bacteria | 3315 |
| 23 | Ga0466690_185002 | 3300042590 | Bacteria | 2087 |
| 24 | Ga0466690_413012 | 3300042590 | Unclassified | 1016 |
| 25 | Ga0466691_057544 | 3300042593 | Bacteria | 3673 |
| 26 | Ga0466694_381535 | 3300042594 | Bacteria | 1264 |
| 27 | Ga0466707_037289 | 3300042601 | Bacteria | 1719 |
| 28 | Ga0466719_052725 | 3300042606 | Bacteria | 9488 |
| 29 | Ga0466712_222923 | 3300042614 | Bacteria | 1133 |
| 30 | Ga0466712_238513 | 3300042614 | Bacteria | 4975 |
| 31 | Ga0466711_083845 | 3300042615 | Bacteria | 3152 |
| 32 | Ga0466703_221397 | 3300042636 | Bacteria | 13829 |
| 33 | Ga0466704_062317 | 3300042643 | Bacteria | 7430 |
| 34 | Ga0466704_078216 | 3300042643 | Bacteria | 3219 |
| 35 | Ga0466704_160887 | 3300042643 | Bacteria | 35133 |
| 36 | Ga0466709_226361 | 3300042648 | Bacteria | 19165 |
| 37 | Ga0466690_216430 | 3300042590 | Bacteria | 5007 |
| 38 | Ga0466716_019913 | 3300042605 | Bacteria | 15015 |
| 39 | Ga0466716_158530 | 3300042605 | Bacteria | 23396 |
| 40 | Ga0466719_420454 | 3300042606 | Bacteria | 7515 |
| 41 | Ga0466722_223232 | 3300042609 | Bacteria | 6609 |
| 42 | JGI24702J35022_10004366 | 3300002462 | Bacteria | 8422 |
| 43 | Ga0466705_035843 | 3300042612 | Bacteria | 27929 |
| 44 | Ga0466705_161281 | 3300042612 | Bacteria | 33011 |
| 45 | Ga0466733_199666 | 3300042659 | Bacteria | 24852 |
| 46 | Ga0466705_510725 | 3300042612 | Bacteria | 2031 |
| 47 | Ga0466711_190939 | 3300042615 | Bacteria | 3014 |
| 48 | Ga0466726_300904 | 3300042619 | Bacteria | 3087 |
| 49 | Ga0466690_058375 | 3300042590 | Bacteria | 3283 |
| 50 | Ga0466692_190769 | 3300042591 | Bacteria | 106111 |
| 51 | Ga0466696_085375 | 3300042596 | Bacteria | 1255 |
| 52 | Ga0466706_020419 | 3300042599 | Bacteria | 1447 |
| 53 | Ga0466706_049945 | 3300042599 | Bacteria | 2150 |
| 54 | Ga0466716_149740 | 3300042605 | Bacteria | 1977 |
| 55 | Ga0466719_294784 | 3300042606 | Bacteria | 5673 |
| 56 | Ga0123355_10003512 | 3300009826 | Bacteria | 22505 |
| 57 | Ga0466705_315074 | 3300042612 | Bacteria | 1027 |
| 58 | Ga0466715_298491 | 3300042616 | Bacteria | 13335 |
| 59 | Ga0466723_230284 | 3300042618 | Bacteria | 2307 |
| 60 | Ga0466704_037388 | 3300042643 | Bacteria | 1702 |
| 61 | Ga0466704_167694 | 3300042643 | Bacteria | 1842 |
| 62 | Ga0466727_309654 | 3300042655 | Bacteria | 1067 |
| 63 | Ga0466707_045474 | 3300042601 | Bacteria | 1085 |
| 64 | Ga0466716_239525 | 3300042605 | Bacteria | 9070 |
| 65 | Ga0466719_272421 | 3300042606 | Bacteria | 3182 |
| 66 | Ga0466719_306064 | 3300042606 | Bacteria | 6430 |
| 67 | Ga0466722_045306 | 3300042609 | Bacteria | 1566 |
| 68 | JGI24698J34947_10031709 | 3300002449 | Bacteria | 2780 |
| 69 | Ga0123357_10009256 | 3300009784 | Bacteria | 12411 |
| 70 | Ga0466715_297001 | 3300042616 | Bacteria | 3631 |
| 71 | Ga0466723_193452 | 3300042618 | Bacteria | 1806 |
| 72 | Ga0466726_126971 | 3300042619 | Bacteria | 10971 |
| 73 | Ga0466728_106715 | 3300042620 | Bacteria | 15608 |
| 74 | Ga0466703_061489 | 3300042636 | Bacteria | 6832 |
| 75 | Ga0466703_106914 | 3300042636 | Bacteria | 14085 |
| 76 | Ga0466704_251320 | 3300042643 | Bacteria | 235343 |
| 77 | Ga0466708_216915 | 3300042652 | Bacteria | 2884 |
| 78 | Ga0466727_057291 | 3300042655 | Bacteria | 1994 |
| 79 | Ga0466690_111654 | 3300042590 | Bacteria | 17140 |
| 80 | Ga0466691_010755 | 3300042593 | Bacteria | 15654 |
| 81 | Ga0466691_031623 | 3300042593 | Bacteria | 7269 |
| 82 | Ga0466691_103240 | 3300042593 | Bacteria | 28955 |
| 83 | Ga0466694_160066 | 3300042594 | Bacteria | 32925 |
| 84 | Ga0466717_037529 | 3300042604 | Bacteria | 1430 |
| 85 | Ga0466716_037984 | 3300042605 | Bacteria | 7353 |
| 86 | Ga0466719_118442 | 3300042606 | Bacteria | 3143 |
| 87 | Ga0466719_143222 | 3300042606 | Bacteria | 16765 |
| 88 | Ga0123357_10304805 | 3300009784 | Bacteria | 1602 |
| 89 | Ga0466733_014231 | 3300042659 | Bacteria | 1394 |
| 90 | Ga0466712_228547 | 3300042614 | Bacteria | 1431 |
| 91 | Ga0466711_215751 | 3300042615 | Bacteria | 1706 |
| 92 | Ga0466711_508141 | 3300042615 | Bacteria | 28214 |
| 93 | Ga0466715_520515 | 3300042616 | Bacteria | 12928 |
| 94 | Ga0466726_172358 | 3300042619 | Bacteria | 17260 |
| 95 | Ga0466708_253425 | 3300042652 | Bacteria | 11269 |
| 96 | Ga0466694_083680 | 3300042594 | Bacteria | 1350 |
| 97 | Ga0466716_091684 | 3300042605 | Bacteria | 2726 |
| 98 | Ga0466716_333462 | 3300042605 | Bacteria | 9932 |
| 99 | Ga0466719_022352 | 3300042606 | Bacteria | 10477 |
| 100 | Ga0466719_281495 | 3300042606 | Bacteria | 2615 |
| 101 | Ga0123357_10069994 | 3300009784 | Bacteria | 4662 |
| 102 | Ga0466705_059730 | 3300042612 | Bacteria | 2463 |
| 103 | Ga0466705_119235 | 3300042612 | Unclassified | 9349 |
| 104 | Ga0466705_234256 | 3300042612 | Bacteria | 9445 |
| 105 | Ga0466733_034561 | 3300042659 | Bacteria | 83410 |
| 106 | Ga0466733_084000 | 3300042659 | Bacteria | 2526 |
| 107 | Ga0466712_016304 | 3300042614 | Bacteria | 11968 |
| 108 | Ga0466715_447524 | 3300042616 | Bacteria | 20272 |
| 109 | Ga0466723_012916 | 3300042618 | Bacteria | 12842 |
| 110 | Ga0466723_271155 | 3300042618 | Bacteria | 10289 |
| 111 | Ga0466723_286489 | 3300042618 | Bacteria | 3816 |
| 112 | Ga0466723_351578 | 3300042618 | Bacteria | 1922 |
| 113 | Ga0466735_034659 | 3300042624 | Bacteria | 1339 |
| 114 | Ga0466709_070696 | 3300042648 | Bacteria | 17498 |
| 115 | Ga0466709_159213 | 3300042648 | Bacteria | 2175 |
| 116 | Ga0466727_312409 | 3300042655 | Bacteria | 1549 |
| 117 | Ga0466727_325392 | 3300042655 | Bacteria | 5786 |
| 118 | Ga0466696_212523 | 3300042596 | Bacteria | 4965 |
| 119 | Ga0466716_103126 | 3300042605 | Bacteria | 8629 |
| 120 | Ga0466719_072769 | 3300042606 | Bacteria | 4255 |
| 121 | JGI24695J34938_10178454 | 3300002450 | Bacteria | 878 |
| 122 | Ga0123353_10637096 | 3300010167 | Bacteria | 1513 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02223 | Thymidylate_kin | Thymidylate kinase | 49 | 237 | 0.91 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.