Protein Family IF02202
Metagenome
Isolate
154
Members
69
Samples
127
Scaffolds
237.17
Avg Length
Representative Sequence
- ID
- 3300009784|Ga0123357_10058319|Ga0123357_100583193
- Length
- 280 aa
- Sequence
- MLLFYAPDIATNRQLPETEAHHCVKVLRMQEGDALWLTDGKGFFYRAEIAEISYQGIAGQARNDKKSNYCMVNLLETIPQPPLWKGTIEIALAPTKNTDRIEWFAEKATEIGIDTISFFRCRFSERKEMSTERILKIMISAMKQSEKARLPVVNAITDFKDFIRQDFDGQKFIAHCHPDEKMLLAQAYHVDENVRILIGPEGDFSEDEISLSKKHGFIPVSLGASRLRTETAALTACQTFHIVNQIVCTPKSTKGDLPQYNIQNHFANSPFRELEGNEL*
Sample Types
Isolate
17.5%
Metagenome
82.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
23.5%
Termitidae
23.5%
Kalotermitidae
19.1%
Unclassified
13.2%
Rhinotermitidae
7.4%
Passalidae
4.4%
Hydrophilidae
2.9%
Termopsidae
2.9%
Tenebrionidae
1.5%
Hodotermitidae
1.5%
Taxonomy
Archaea
0
Bacteria
151
Eukaryota
0
Viruses
0
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 2 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 3 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 4 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 5 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 6 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 7 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 8 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 9 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 10 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 11 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 12 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 13 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 14 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 15 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 16 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 17 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 18 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 19 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 20 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 21 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 22 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 23 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 24 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 25 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 26 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 27 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 28 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 29 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 30 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 31 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 32 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 33 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 34 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 35 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 36 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 37 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 38 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 39 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 40 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 41 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 42 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 43 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 44 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 45 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 46 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 47 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 48 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 49 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 50 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 51 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 52 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 53 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 54 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 55 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 56 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 57 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 58 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 59 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 60 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 61 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 62 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 63 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 64 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 65 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 66 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 67 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 68 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 69 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_376098 | 3300042612 | Unclassified | 1711 |
| 2 | Ga0466733_028288 | 3300042659 | Bacteria | 11210 |
| 3 | Ga0466733_094779 | 3300042659 | Bacteria | 1906 |
| 4 | Ga0466706_121012 | 3300042599 | Bacteria | 39559 |
| 5 | Ga0466713_096596 | 3300042602 | Bacteria | 406546 |
| 6 | Ga0466719_343976 | 3300042606 | Bacteria | 3739 |
| 7 | Ga0466735_048585 | 3300042624 | Bacteria | 7043 |
| 8 | Ga0466735_054717 | 3300042624 | Bacteria | 2562 |
| 9 | Ga0466703_352236 | 3300042636 | Bacteria | 13812 |
| 10 | Ga0466705_471727 | 3300042612 | Bacteria | 3420 |
| 11 | Ga0466733_202134 | 3300042659 | Bacteria | 48711 |
| 12 | Ga0466706_107962 | 3300042599 | Bacteria | 3768 |
| 13 | Ga0466706_224673 | 3300042599 | Bacteria | 38412 |
| 14 | Ga0466713_132298 | 3300042602 | Bacteria | 14712 |
| 15 | 2227538524 | 2225789004 | Bacteria | 15833 |
| 16 | IMNBL1DRAFT_c0010237 | 3300000062 | Bacteria | 4521 |
| 17 | JGI24702J35022_10040358 | 3300002462 | Bacteria | 2489 |
| 18 | JGI24699J35502_11134060 | 3300002509 | Bacteria | 27589 |
| 19 | Ga0466729_276655 | 3300042621 | Bacteria | 1602 |
| 20 | Ga0466735_024444 | 3300042624 | Bacteria | 1764 |
| 21 | Ga0466704_125688 | 3300042643 | Bacteria | 12394 |
| 22 | Ga0466709_077519 | 3300042648 | Bacteria | 9059 |
| 23 | Ga0466690_250711 | 3300042590 | Bacteria | 19853 |
| 24 | Ga0123357_10058319 | 3300009784 | Bacteria | 5184 |
| 25 | Ga0123357_10086522 | 3300009784 | Bacteria | 4100 |
| 26 | Ga0123353_10613520 | 3300010167 | Bacteria | 1551 |
| 27 | Ga0123354_10029273 | 3300010882 | Bacteria | 8667 |
| 28 | Ga0123354_10052241 | 3300010882 | Bacteria | 6159 |
| 29 | Ga0123354_10431483 | 3300010882 | Bacteria | 1085 |
| 30 | Ga0466710_275465 | 3300042613 | Bacteria | 2623 |
| 31 | Ga0466711_045620 | 3300042615 | Bacteria | 22798 |
| 32 | Ga0466711_392107 | 3300042615 | Bacteria | 21134 |
| 33 | Ga0466705_183444 | 3300042612 | Bacteria | 1691 |
| 34 | Ga0466705_281432 | 3300042612 | Bacteria | 24457 |
| 35 | Ga0466701_072055 | 3300042598 | Bacteria | 39896 |
| 36 | Ga0466706_009507 | 3300042599 | Bacteria | 49149 |
| 37 | Ga0466706_166563 | 3300042599 | Bacteria | 29380 |
| 38 | Ga0466700_366097 | 3300042600 | Bacteria | 2630 |
| 39 | Ga0466707_138118 | 3300042601 | Bacteria | 2345 |
| 40 | Ga0466707_295623 | 3300042601 | Bacteria | 1115 |
| 41 | Ga0466713_125888 | 3300042602 | Bacteria | 191726 |
| 42 | Ga0466713_134411 | 3300042602 | Bacteria | 55260 |
| 43 | JGI24699J35502_11133282 | 3300002509 | Bacteria | 9610 |
| 44 | JGI24699J35502_11134081 | 3300002509 | Bacteria | 28828 |
| 45 | Ga0072941_1169568 | 3300005201 | Bacteria | 868 |
| 46 | Ga0466735_015687 | 3300042624 | Bacteria | 4198 |
| 47 | Ga0466702_107576 | 3300042635 | Bacteria | 1993 |
| 48 | Ga0466703_202653 | 3300042636 | Bacteria | 3738 |
| 49 | Ga0466708_140172 | 3300042652 | Bacteria | 30570 |
| 50 | Ga0123357_10004606 | 3300009784 | Bacteria | 16255 |
| 51 | Ga0123357_10371846 | 3300009784 | Bacteria | 1339 |
| 52 | Ga0123354_10051129 | 3300010882 | Bacteria | 6243 |
| 53 | Ga0466715_130401 | 3300042616 | Bacteria | 3774 |
| 54 | Ga0466715_320642 | 3300042616 | Bacteria | 27497 |
| 55 | Ga0466733_220888 | 3300042659 | Bacteria | 25948 |
| 56 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 57 | Ga0466706_109717 | 3300042599 | Bacteria | 38259 |
| 58 | Ga0466706_249816 | 3300042599 | Bacteria | 12942 |
| 59 | Ga0466707_046218 | 3300042601 | Bacteria | 6341 |
| 60 | Ga0466713_130991 | 3300042602 | Bacteria | 214088 |
| 61 | Ga0466719_341919 | 3300042606 | Bacteria | 1506 |
| 62 | Ga0466735_073816 | 3300042624 | Bacteria | 2112 |
| 63 | Ga0466735_139907 | 3300042624 | Bacteria | 1947 |
| 64 | Ga0466735_181415 | 3300042624 | Bacteria | 3634 |
| 65 | Ga0466690_355258 | 3300042590 | Bacteria | 7700 |
| 66 | Ga0123357_10005407 | 3300009784 | Bacteria | 15290 |
| 67 | Ga0466711_006830 | 3300042615 | Bacteria | 29316 |
| 68 | Ga0466729_176443 | 3300042621 | Bacteria | 21516 |
| 69 | Ga0466697_175217 | 3300042611 | Bacteria | 24944 |
| 70 | Ga0466705_323042 | 3300042612 | Bacteria | 4912 |
| 71 | Ga0466705_349592 | 3300042612 | Bacteria | 3165 |
| 72 | Ga0466733_074294 | 3300042659 | Bacteria | 93274 |
| 73 | Ga0466706_242401 | 3300042599 | Bacteria | 7115 |
| 74 | Ga0466707_096581 | 3300042601 | Bacteria | 1082 |
| 75 | Ga0466707_096776 | 3300042601 | Unclassified | 1759 |
| 76 | Ga0466707_232641 | 3300042601 | Bacteria | 41634 |
| 77 | 2227079941 | 2225789003 | Unclassified | 2023 |
| 78 | IMNBL1DRAFT_c0019303 | 3300000062 | Bacteria | 2798 |
| 79 | Ga0466735_135242 | 3300042624 | Bacteria | 1844 |
| 80 | Ga0466735_224687 | 3300042624 | Bacteria | 7662 |
| 81 | Ga0466730_068888 | 3300042625 | Bacteria | 3292 |
| 82 | Ga0466703_262959 | 3300042636 | Bacteria | 29096 |
| 83 | Ga0466704_181421 | 3300042643 | Bacteria | 11545 |
| 84 | Ga0466708_084131 | 3300042652 | Bacteria | 6382 |
| 85 | Ga0466691_124508 | 3300042593 | Bacteria | 35460 |
| 86 | Ga0123357_10006182 | 3300009784 | Bacteria | 14525 |
| 87 | Ga0466711_015866 | 3300042615 | Bacteria | 1157 |
| 88 | Ga0466715_164258 | 3300042616 | Bacteria | 10014 |
| 89 | Ga0466706_051411 | 3300042599 | Bacteria | 14066 |
| 90 | Ga0466735_086464 | 3300042624 | Bacteria | 5544 |
| 91 | Ga0466735_199641 | 3300042624 | Bacteria | 1682 |
| 92 | Ga0466704_397114 | 3300042643 | Bacteria | 24756 |
| 93 | Ga0466708_200901 | 3300042652 | Bacteria | 4214 |
| 94 | Ga0466692_199363 | 3300042591 | Bacteria | 30623 |
| 95 | Ga0466695_044334 | 3300042595 | Bacteria | 3068 |
| 96 | Ga0123356_10687311 | 3300010049 | Bacteria | 1192 |
| 97 | Ga0123354_10015532 | 3300010882 | Bacteria | 11896 |
| 98 | Ga0123354_10040937 | 3300010882 | Bacteria | 7163 |
| 99 | Ga0466728_331236 | 3300042620 | Bacteria | 43818 |
| 100 | Ga0466716_441348 | 3300042605 | Bacteria | 12409 |
| 101 | Ga0466698_391706 | 3300042610 | Bacteria | 3687 |
| 102 | IMNBL1DRAFT_c0000965 | 3300000062 | Bacteria | 22212 |
| 103 | Ga0072941_1042687 | 3300005201 | Bacteria | 4764 |
| 104 | Ga0123357_10000752 | 3300009784 | Bacteria | 32677 |
| 105 | Ga0466734_136439 | 3300042623 | Bacteria | 1114 |
| 106 | Ga0466704_047237 | 3300042643 | Bacteria | 3043 |
| 107 | Ga0466704_144742 | 3300042643 | Bacteria | 4128 |
| 108 | Ga0466727_237302 | 3300042655 | Bacteria | 10168 |
| 109 | Ga0466692_175726 | 3300042591 | Bacteria | 1180 |
| 110 | Ga0123356_10577058 | 3300010049 | Bacteria | 1288 |
| 111 | Ga0466710_312237 | 3300042613 | Bacteria | 6688 |
| 112 | Ga0466715_332133 | 3300042616 | Bacteria | 83480 |
| 113 | Ga0466701_089428 | 3300042598 | Bacteria | 9441 |
| 114 | Ga0466707_374545 | 3300042601 | Bacteria | 11431 |
| 115 | Ga0466716_085926 | 3300042605 | Bacteria | 4722 |
| 116 | Ga0466716_410963 | 3300042605 | Bacteria | 3557 |
| 117 | Ga0466719_047405 | 3300042606 | Bacteria | 4133 |
| 118 | Ga0466698_052603 | 3300042610 | Bacteria | 1580 |
| 119 | 2227008134 | 2225789003 | Bacteria | 27277 |
| 120 | Ga0068305_10003714 | 3300005083 | Bacteria | 240854 |
| 121 | Ga0466735_006600 | 3300042624 | Bacteria | 3088 |
| 122 | Ga0466735_152891 | 3300042624 | Bacteria | 1920 |
| 123 | Ga0466690_373583 | 3300042590 | Bacteria | 20133 |
| 124 | Ga0466696_454722 | 3300042596 | Bacteria | 41485 |
| 125 | Ga0123354_10138266 | 3300010882 | Bacteria | 3031 |
| 126 | Ga0466711_471547 | 3300042615 | Bacteria | 15822 |
| 127 | Ga0466715_609492 | 3300042616 | Bacteria | 9096 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.