Protein Family IF01889
Metagenome
Isolate
139
Members
63
Samples
123
Scaffolds
238.15
Avg Length
Representative Sequence
- ID
- 3300007190|Ga0103267_1000536|Ga0103267_10005362
- Length
- 272 aa
- Sequence
- VDTFTHTEKRFPHEKIKFAPENEIIKRYTTKQPKFMGRAFEYRRAAKEKRWDKMSRIFPRLGKAITMAAKEGGQDPDTNAALRTAIKNAKAQNMPKDNIDAAIKRATSKDAEAYAEINYEGKGPHGVLVFVECATDNPNRTVANVKSYFNKAGGSIVPNGSLDFMFNRKAVFEFEKTEQIDTEELELELIDAGLEEIENVEETIFVYGDYTAFGSLSEALEKLNIDVKKSNLQRIPTSPVEFSEEQLVDIEKMLDKIEDDDDIQQVFTNIA*
Sample Types
Isolate
11.5%
Metagenome
88.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
21.0%
Kalotermitidae
17.7%
Unclassified
16.1%
Formicidae
14.5%
Blattidae
9.7%
Drosophilidae
6.5%
Rhinotermitidae
3.2%
Tenebrionidae
3.2%
Termopsidae
3.2%
Hodotermitidae
1.6%
Passalidae
1.6%
Kiwaidae
1.6%
Taxonomy
Archaea
0
Bacteria
121
Eukaryota
0
Viruses
0
Unclassified
18
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820750388 | Unclassified Bacteroidetes Nt197P3bin50 | Isolate | Unclassified |
| 2 | 2820751898 | Unclassified Bacteroidetes Nc150P4bin22 | Isolate | Unclassified |
| 3 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 4 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 5 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 6 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 7 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 8 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 9 | 2627854132 | Campylobacter peloridis LMG 23910 | Isolate | Unclassified |
| 10 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 11 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 12 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 13 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 14 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 15 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 16 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 17 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 18 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 19 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 20 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 21 | 2870004507 | Campylobacter coli 14983A | Isolate | Unclassified |
| 22 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 23 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 24 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 25 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 26 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 27 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 28 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 29 | 2899132286 | Myroides albus BIT-d1 | Isolate | Tenebrionidae |
| 30 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 31 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 32 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 33 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 34 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 35 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 36 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 37 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 38 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 39 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 40 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 41 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 42 | 2820789850 | Unclassified Bacteroidetes Cu122P3bin3 | Isolate | Unclassified |
| 43 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 44 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 45 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 46 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 47 | 3300005307 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 1 gut | Metagenome | Drosophilidae |
| 48 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 49 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 50 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 51 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 52 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 53 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 54 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 55 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 56 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 57 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 58 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 59 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 60 | 3300007733 | Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean | Metagenome | |
| 61 | 3300013007 | Symbiotic microbial communities associated with the hydrothermal yeti crab kiwa sp. n. from the East Pacific Rise in the East Pacific Ocean - crab 1, guts | Metagenome | Kiwaidae |
| 62 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 63 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466706_061662 | 3300042599 | Bacteria | 7672 |
| 2 | Ga0466713_146264 | 3300042602 | Bacteria | 1701 |
| 3 | Ga0466714_007872 | 3300042603 | Unclassified | 2888 |
| 4 | Ga0466714_043034 | 3300042603 | Unclassified | 1419 |
| 5 | Ga0466714_126151 | 3300042603 | Bacteria | 4932 |
| 6 | Ga0466690_158733 | 3300042590 | Bacteria | 2643 |
| 7 | Ga0466696_025646 | 3300042596 | Bacteria | 6797 |
| 8 | Ga0466696_180685 | 3300042596 | Bacteria | 38837 |
| 9 | Ga0466701_003736 | 3300042598 | Bacteria | 61016 |
| 10 | JGI24702J35022_10025819 | 3300002462 | Bacteria | 3167 |
| 11 | Ga0104048_1003069 | 3300007143 | Bacteria | 9543 |
| 12 | Ga0103268_1000155 | 3300007192 | Bacteria | 22376 |
| 13 | Ga0123357_10000340 | 3300009784 | Bacteria | 44197 |
| 14 | Ga0466711_133919 | 3300042615 | Unclassified | 3199 |
| 15 | Ga0466715_246897 | 3300042616 | Bacteria | 37494 |
| 16 | Ga0466709_060234 | 3300042648 | Bacteria | 2458 |
| 17 | Ga0466733_035462 | 3300042659 | Bacteria | 10854 |
| 18 | Ga0466733_045198 | 3300042659 | Bacteria | 4949 |
| 19 | Ga0466733_105174 | 3300042659 | Bacteria | 3256 |
| 20 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 21 | Ga0466706_104447 | 3300042599 | Unclassified | 3251 |
| 22 | Ga0466706_217250 | 3300042599 | Bacteria | 41329 |
| 23 | Ga0466706_256901 | 3300042599 | Bacteria | 3639 |
| 24 | Ga0466716_508727 | 3300042605 | Bacteria | 29958 |
| 25 | Ga0466690_077896 | 3300042590 | Bacteria | 14270 |
| 26 | Ga0466696_116170 | 3300042596 | Bacteria | 3975 |
| 27 | Ga0466701_011125 | 3300042598 | Bacteria | 31883 |
| 28 | Ga0074308_1113691 | 3300005307 | Bacteria | 2861 |
| 29 | Ga0104048_1000738 | 3300007143 | Bacteria | 3444 |
| 30 | Ga0103267_1000536 | 3300007190 | Bacteria | 12024 |
| 31 | Ga0105524_104928 | 3300007733 | Bacteria | 3554 |
| 32 | Ga0105524_105787 | 3300007733 | Bacteria | 1269 |
| 33 | Ga0466733_032988 | 3300042659 | Bacteria | 33257 |
| 34 | Ga0466733_079531 | 3300042659 | Unclassified | 1082 |
| 35 | Ga0466706_050067 | 3300042599 | Bacteria | 35562 |
| 36 | Ga0466706_112779 | 3300042599 | Bacteria | 11684 |
| 37 | Ga0466716_080663 | 3300042605 | Bacteria | 7562 |
| 38 | Ga0157631_137297 | 3300013007 | Bacteria | 1162 |
| 39 | Ga0466694_042143 | 3300042594 | Bacteria | 1845 |
| 40 | JGI24702J35022_10177033 | 3300002462 | Bacteria | 1210 |
| 41 | Ga0103266_1000353 | 3300007067 | Bacteria | 17634 |
| 42 | Ga0103260_1000027 | 3300007139 | Bacteria | 71480 |
| 43 | Ga0103267_1000391 | 3300007190 | Bacteria | 14813 |
| 44 | Ga0466711_069689 | 3300042615 | Unclassified | 14407 |
| 45 | Ga0466723_142663 | 3300042618 | Bacteria | 4548 |
| 46 | Ga0466723_160704 | 3300042618 | Bacteria | 10736 |
| 47 | Ga0466723_183938 | 3300042618 | Bacteria | 8946 |
| 48 | Ga0466726_044927 | 3300042619 | Bacteria | 2853 |
| 49 | Ga0466728_138908 | 3300042620 | Bacteria | 9000 |
| 50 | Ga0466709_167096 | 3300042648 | Bacteria | 11219 |
| 51 | Ga0466724_31268 | 3300042649 | Bacteria | 225286 |
| 52 | Ga0466733_051324 | 3300042659 | Bacteria | 11325 |
| 53 | Ga0466733_112768 | 3300042659 | Bacteria | 26659 |
| 54 | Ga0466733_168571 | 3300042659 | Bacteria | 14566 |
| 55 | Ga0466706_062384 | 3300042599 | Bacteria | 15309 |
| 56 | Ga0466707_269285 | 3300042601 | Bacteria | 5262 |
| 57 | Ga0466714_018806 | 3300042603 | Unclassified | 1281 |
| 58 | Ga0123356_10058663 | 3300010049 | Bacteria | 3590 |
| 59 | Ga0123353_10668216 | 3300010167 | Bacteria | 1466 |
| 60 | Ga0157631_112872 | 3300013007 | Bacteria | 1447 |
| 61 | Ga0157631_136737 | 3300013007 | Bacteria | 5847 |
| 62 | Ga0466696_005041 | 3300042596 | Bacteria | 9500 |
| 63 | IMNBL1DRAFT_c0012144 | 3300000062 | Bacteria | 3959 |
| 64 | Ga0102740_1000054 | 3300007140 | Unclassified | 27264 |
| 65 | Ga0103267_1000009 | 3300007190 | Bacteria | 74171 |
| 66 | Ga0466711_340423 | 3300042615 | Bacteria | 2398 |
| 67 | Ga0466733_026339 | 3300042659 | Bacteria | 1581 |
| 68 | Ga0466701_058067 | 3300042598 | Bacteria | 74144 |
| 69 | Ga0466706_011591 | 3300042599 | Bacteria | 14693 |
| 70 | Ga0466706_036123 | 3300042599 | Bacteria | 40157 |
| 71 | Ga0466706_059283 | 3300042599 | Bacteria | 2416 |
| 72 | Ga0466706_198060 | 3300042599 | Bacteria | 17980 |
| 73 | Ga0466706_265268 | 3300042599 | Bacteria | 15915 |
| 74 | Ga0466713_010388 | 3300042602 | Bacteria | 14180 |
| 75 | Ga0466714_012360 | 3300042603 | Bacteria | 1156 |
| 76 | Ga0466714_125806 | 3300042603 | Bacteria | 34866 |
| 77 | Ga0466722_252268 | 3300042609 | Bacteria | 10996 |
| 78 | CVPL010W_10005250 | 3300002931 | Bacteria | 13940 |
| 79 | Ga0102739_1000267 | 3300007095 | Bacteria | 12363 |
| 80 | Ga0105524_100415 | 3300007733 | Bacteria | 20497 |
| 81 | Ga0466728_181221 | 3300042620 | Bacteria | 31399 |
| 82 | Ga0466703_048013 | 3300042636 | Bacteria | 219350 |
| 83 | Ga0466733_187687 | 3300042659 | Bacteria | 3397 |
| 84 | Ga0466706_017256 | 3300042599 | Unclassified | 2020 |
| 85 | Ga0466706_114796 | 3300042599 | Bacteria | 4102 |
| 86 | Ga0466714_138691 | 3300042603 | Unclassified | 1352 |
| 87 | Ga0466714_142339 | 3300042603 | Unclassified | 3458 |
| 88 | Ga0466719_042388 | 3300042606 | Bacteria | 6529 |
| 89 | Ga0157631_100610 | 3300013007 | Bacteria | 2444 |
| 90 | Ga0466690_008835 | 3300042590 | Bacteria | 27085 |
| 91 | Ga0104045_1005006 | 3300007085 | Bacteria | 3120 |
| 92 | Ga0466726_171597 | 3300042619 | Bacteria | 6067 |
| 93 | Ga0466728_398132 | 3300042620 | Bacteria | 32620 |
| 94 | Ga0466703_282847 | 3300042636 | Bacteria | 34480 |
| 95 | Ga0466732_096678 | 3300042656 | Bacteria | 23115 |
| 96 | Ga0466732_447361 | 3300042656 | Bacteria | 66921 |
| 97 | Ga0466733_218682 | 3300042659 | Bacteria | 17098 |
| 98 | Ga0466706_021280 | 3300042599 | Bacteria | 24208 |
| 99 | Ga0466714_125354 | 3300042603 | Unclassified | 5370 |
| 100 | Ga0123354_10049157 | 3300010882 | Bacteria | 6400 |
| 101 | Ga0123354_10244638 | 3300010882 | Bacteria | 1835 |
| 102 | Ga0466657_387007 | 3300042582 | Bacteria | 76676 |
| 103 | Ga0068305_10378891 | 3300005083 | Bacteria | 1740 |
| 104 | Ga0104045_1026361 | 3300007085 | Unclassified | 3819 |
| 105 | Ga0104048_1175526 | 3300007143 | Bacteria | 1048 |
| 106 | Ga0103268_1001214 | 3300007192 | Bacteria | 6625 |
| 107 | Ga0466709_136725 | 3300042648 | Unclassified | 21180 |
| 108 | Ga0466708_305107 | 3300042652 | Bacteria | 23468 |
| 109 | Ga0466733_016851 | 3300042659 | Bacteria | 20196 |
| 110 | Ga0466733_073117 | 3300042659 | Bacteria | 5276 |
| 111 | Ga0466706_002280 | 3300042599 | Unclassified | 1023 |
| 112 | Ga0466706_046752 | 3300042599 | Bacteria | 7867 |
| 113 | Ga0466706_095810 | 3300042599 | Bacteria | 22568 |
| 114 | Ga0466706_103607 | 3300042599 | Bacteria | 38782 |
| 115 | Ga0466700_492090 | 3300042600 | Bacteria | 1316 |
| 116 | Ga0466714_074988 | 3300042603 | Bacteria | 2014 |
| 117 | Ga0466714_132716 | 3300042603 | Unclassified | 1406 |
| 118 | Ga0466722_252949 | 3300042609 | Bacteria | 7852 |
| 119 | CVPL005W_1000145 | 3300002934 | Bacteria | 30557 |
| 120 | Ga0068305_10010097 | 3300005083 | Bacteria | 67125 |
| 121 | Ga0103261_1000046 | 3300007083 | Unclassified | 39142 |
| 122 | Ga0104019_1034625 | 3300007150 | Unclassified | 2218 |
| 123 | Ga0466735_180494 | 3300042624 | Bacteria | 2824 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.