Protein Family IF01878
Metagenome
Isolate
226
Members
172
Samples
90
Scaffolds
283.36
Avg Length
Representative Sequence
- ID
- 3300007188|Ga0103264_1035007|Ga0103264_10350072
- Length
- 342 aa
- Sequence
- MPGFAIGSYCPIYGFKPCVIGTKDLKPALFCCPGIDFRRIVSTFVSITVQDMATLELMSQHRCFNGWQRYYRHVSDEIGLPMQFSAYVPPQAETGRVATLFYLAGLTCTEETFAIKAGAQRLASELGLMLIAPDTSPRDAGVPGENEDWDFGTGAGFYLDATQAPWQRHYRMESYLTKELYRIATDELPGDARRIGIFGHSMGGHGALTLALRHPGQYHSVSAFAPIAAPSRCPWGEKAFGGYLGNDRSTWVEHDASELMRKQLTAPYPDGMLIDQGNDDPFLHAGQLLPDAFETACAQVGQPLTLRRHEGYDHGYFFIATFMAAHLHFHQARLVASPTMP*
Sample Types
Isolate
60.2%
Metagenome
39.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Coreidae
45.5%
Unclassified
12.0%
Elmidae
9.6%
Formicidae
9.0%
Termitidae
6.6%
Culicidae
4.2%
Curculionidae
2.4%
Armadillidiidae
2.4%
Berytidae
1.2%
Nephropidae
1.2%
Hydrophilidae
1.2%
Largidae
1.2%
Lysianassidae
0.6%
Apidae
0.6%
Crambidae
0.6%
Noctuidae
0.6%
Alydidae
0.6%
Drosophilidae
0.6%
Taxonomy
Archaea
0
Bacteria
210
Eukaryota
0
Viruses
0
Unclassified
16
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2848339753 | Ephemeroptericola cinctiostellae F02 | Isolate | Unclassified |
| 2 | 2864804954 | Acinetobacter johnsonii S00050 | Isolate | Elmidae |
| 3 | 2864973726 | Acinetobacter schindleri S00243 | Isolate | Elmidae |
| 4 | 2864976888 | Novosphingobium chloroacetimidivorans S00245 | Isolate | Elmidae |
| 5 | 2585428048 | Colwellia sp. NBT2012 | Isolate | |
| 6 | 8022116796 | Vibrio sp. T3Y01 | Isolate | Unclassified |
| 7 | 8023724303 | Caballeronia zhejiangensis LP003 | Isolate | Coreidae |
| 8 | 8024001094 | Caballeronia sp. TF1N1 | Isolate | Berytidae |
| 9 | 8025666332 | Caballeronia grimmiae LZ050 | Isolate | Coreidae |
| 10 | 8025694439 | Caballeronia cordobensis LZ033 | Isolate | Coreidae |
| 11 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 12 | 8102007614 | Caballeronia sp. ATUFL_M1_KS5A | Isolate | Coreidae |
| 13 | 8102041249 | Caballeronia sp. GACF4 | Isolate | Coreidae |
| 14 | 8102087471 | Caballeronia sp. GAWG2-1 | Isolate | Coreidae |
| 15 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
| 16 | 2989793055 | Vibrio atypicus DSM 25292 | Isolate | Unclassified |
| 17 | 3006190525 | Acinetobacter sp. S54 | Isolate | Curculionidae |
| 18 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 19 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 20 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 21 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 22 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 23 | 2835143510 | Yoonia maritima YPC211 | Isolate | Nephropidae |
| 24 | 2864826666 | Acidovorax konjaci S00067 | Isolate | Elmidae |
| 25 | 2873571580 | Diaphorobacter sp. HDW4B | Isolate | Hydrophilidae |
| 26 | 2912636047 | Vibrio crassostreae 9CS106 | Isolate | Unclassified |
| 27 | 2501651205 | Colwellia sp. MT41 | Isolate | Lysianassidae |
| 28 | 2806310572 | Pukyongiella litopenaei SH-1 | Isolate | Unclassified |
| 29 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 30 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 31 | 8021899934 | Acinetobacter sp. AR2-3 | Isolate | Culicidae |
| 32 | 8025716094 | Caballeronia zhejiangensis LZ028 | Isolate | Coreidae |
| 33 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 34 | 8101988189 | Caballeronia sp. ATUFL_F1_KS4A | Isolate | Coreidae |
| 35 | 8102014801 | Caballeronia sp. ATUFL_M2_KS44 | Isolate | Coreidae |
| 36 | 8102060671 | Caballeronia sp. GAFFF2 | Isolate | Coreidae |
| 37 | 8102152052 | Caballeronia sp. LZ001 | Isolate | Coreidae |
| 38 | 8102208438 | Caballeronia sp. LZ032 | Isolate | Coreidae |
| 39 | 8102251710 | Caballeronia sp. LZ065 | Isolate | Coreidae |
| 40 | 8102279326 | Caballeronia sp. NCTM1 | Isolate | Coreidae |
| 41 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 42 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 43 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 44 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 45 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 46 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 47 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 48 | 2864755708 | Massilia timonae S00006 | Isolate | Elmidae |
| 49 | 2864863795 | Acinetobacter johnsonii S00116 | Isolate | Elmidae |
| 50 | 2600255074 | Vibrio proteolyticus NBRC 13287 | Isolate | Unclassified |
| 51 | 2816332545 | Tritonibacter mobilis S1923 | Isolate | Unclassified |
| 52 | 2820115951 | Unclassified Proteobacteria Emb289P4bin33 | Isolate | Unclassified |
| 53 | 8022345672 | Vibrio sp. 070316B | Isolate | Unclassified |
| 54 | 8023747282 | Caballeronia zhejiangensis LZ019 | Isolate | Coreidae |
| 55 | 8024025509 | Caballeronia grimmiae Lep1A1 | Isolate | Coreidae |
| 56 | 8024037630 | Caballeronia zhejiangensis A33_M4_a | Isolate | Coreidae |
| 57 | 8025685901 | Caballeronia fortuita LZ035 | Isolate | Coreidae |
| 58 | 8025723035 | Caballeronia grimmiae LZ025 | Isolate | Coreidae |
| 59 | 8025756023 | Caballeronia peredens LZ002 | Isolate | Coreidae |
| 60 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 61 | 8100455565 | Delftia sp. S67 | Isolate | Curculionidae |
| 62 | 8102054868 | Caballeronia sp. GAFFF1 | Isolate | Coreidae |
| 63 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 64 | 8102161003 | Caballeronia sp. LZ002 | Isolate | Coreidae |
| 65 | 8102246966 | Caballeronia sp. LZ050 | Isolate | Coreidae |
| 66 | 3003869270 | Paraburkholderia sp. PGU16 | Isolate | Largidae |
| 67 | 3006156446 | Acinetobacter baretiae B10A | Isolate | Apidae |
| 68 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 69 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 70 | 2864843793 | Acinetobacter johnsonii S00075 | Isolate | Elmidae |
| 71 | 2864870719 | Comamonas odontotermitis S00124 | Isolate | Elmidae |
| 72 | 2864937364 | Acidovorax soli S00198 | Isolate | Elmidae |
| 73 | 2963630348 | Burkholderiales bacterium 3487_49 | Isolate | Formicidae |
| 74 | 2711768158 | Vibrio coralliilyticus S2043 | Isolate | Unclassified |
| 75 | 2816332503 | Tritonibacter mobilis S1611 | Isolate | Unclassified |
| 76 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 77 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 78 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 79 | 8025650824 | Caballeronia hypogeia LZ032 | Isolate | Coreidae |
| 80 | 8025671076 | Caballeronia cordobensis LZ034LL | Isolate | Coreidae |
| 81 | 8025735396 | Caballeronia zhejiangensis LZ016 | Isolate | Coreidae |
| 82 | 8102047609 | Caballeronia sp. GACF5 | Isolate | Coreidae |
| 83 | 8102074813 | Caballeronia sp. GAWG1-1 | Isolate | Coreidae |
| 84 | 8102081745 | Caballeronia sp. GAWG1-5s-s | Isolate | Coreidae |
| 85 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 86 | 8102131453 | Caballeronia sp. INML5 | Isolate | Coreidae |
| 87 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 88 | 8102216467 | Caballeronia sp. LZ033 | Isolate | Coreidae |
| 89 | 8102230706 | Caballeronia sp. LZ035 | Isolate | Coreidae |
| 90 | 8102239244 | Caballeronia sp. LZ043 | Isolate | Coreidae |
| 91 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 92 | 2864812326 | Chitinimonas taiwanensis S00057 | Isolate | Elmidae |
| 93 | 2864874997 | Acinetobacter lwoffii S00127 | Isolate | Elmidae |
| 94 | 2864960361 | Comamonas odontotermitis S00229 | Isolate | Elmidae |
| 95 | 2687453742 | Burkholderiales bacterium B_Cag20 | Isolate | Unclassified |
| 96 | 8023757577 | Caballeronia peredens LP006 | Isolate | Coreidae |
| 97 | 8023764196 | Caballeronia peredens LZ001 | Isolate | Coreidae |
| 98 | 8025678175 | Caballeronia hypogeia LZ043 | Isolate | Coreidae |
| 99 | 8025747911 | Caballeronia peredens LZ003 | Isolate | Coreidae |
| 100 | 8069755105 | Caballeronia sp. LZ003 | Isolate | Coreidae |
| 101 | 8069775773 | Caballeronia sp. LZ062 | Isolate | Coreidae |
| 102 | 8100461708 | Delftia sp. S65 | Isolate | Curculionidae |
| 103 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 104 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 105 | 8101981714 | Caballeronia sp. ATUFL_F1_KS39 | Isolate | Coreidae |
| 106 | 8102020860 | Caballeronia sp. AZ10_KS36 | Isolate | Coreidae |
| 107 | 8102026984 | Caballeronia sp. AZ1_KS37 | Isolate | Coreidae |
| 108 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
| 109 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 110 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 111 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 112 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 113 | 2841330038 | Sulfitobacter sp. D7 | Isolate | |
| 114 | 2855798354 | Achromobacter insolitus AR476-2 | Isolate | Crambidae |
| 115 | 2864808494 | Chitinimonas taiwanensis S00056 | Isolate | Elmidae |
| 116 | 2864934081 | Brevundimonas vesicularis S00192 | Isolate | Elmidae |
| 117 | 2528768159 | Alteromonadaceae bacterium Bs31 | Isolate | Unclassified |
| 118 | 2531839311 | Acinetobacter sp. HA | Isolate | Noctuidae |
| 119 | 2597489944 | Caballeronia insecticola RPE64 | Isolate | Alydidae |
| 120 | 2648501158 | Vibrio hepatarius DSM 19134 | Isolate | Unclassified |
| 121 | 2718218026 | Phaeobacter porticola P97 | Isolate | Unclassified |
| 122 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 123 | 8023752828 | Caballeronia grimmiae LZ062 | Isolate | Coreidae |
| 124 | 8024019580 | Caballeronia sp. Lep1P3 | Isolate | Coreidae |
| 125 | 8024044713 | Caballeronia sp. Sq4a | Isolate | Coreidae |
| 126 | 8069763219 | Caballeronia sp. LZ008 | Isolate | Coreidae |
| 127 | 8100449422 | Delftia sp. S66 | Isolate | Curculionidae |
| 128 | 8102001125 | Caballeronia sp. ATUFL_F2_KS9A | Isolate | Coreidae |
| 129 | 8102169119 | Caballeronia sp. LZ016 | Isolate | Coreidae |
| 130 | 8102181083 | Caballeronia sp. LZ025 | Isolate | Coreidae |
| 131 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
| 132 | 3003878002 | Paraburkholderia sp. PGU19 | Isolate | Largidae |
| 133 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 134 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 135 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 136 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 137 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 138 | 2839785767 | Thalassobius sp. I31.1 | Isolate | Nephropidae |
| 139 | 2585427605 | Colwellia sp. MT2012 | Isolate | |
| 140 | 2687453753 | Burkholderiales bacterium B_Cag25 | Isolate | Unclassified |
| 141 | 2791355471 | Vibrio bivalvicida 605 | Isolate | Unclassified |
| 142 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 143 | 8024014383 | Caballeronia sp. SL2Y3 | Isolate | Berytidae |
| 144 | 8025740903 | Caballeronia zhejiangensis LZ008 | Isolate | Coreidae |
| 145 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 146 | 8102033761 | Caballeronia sp. AZ7_KS35 | Isolate | Coreidae |
| 147 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 148 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 149 | 8102145433 | Caballeronia sp. LP006 | Isolate | Coreidae |
| 150 | 8102186987 | Caballeronia sp. LZ028 | Isolate | Coreidae |
| 151 | 8102223607 | Caballeronia sp. LZ034LL | Isolate | Coreidae |
| 152 | 8102286609 | Caballeronia sp. NCTM5 | Isolate | Coreidae |
| 153 | 3006242587 | Vibrio sp. RE86 | Isolate | Unclassified |
| 154 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 155 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 156 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 157 | 2864840607 | Acinetobacter johnsonii S00071 | Isolate | Elmidae |
| 158 | 2864968865 | Paucibacter oligotrophus S00239 | Isolate | Elmidae |
| 159 | 2873565274 | Diaphorobacter sp. HDW4A | Isolate | Hydrophilidae |
| 160 | 2603880165 | Burkholderiales A1 | Isolate | Unclassified |
| 161 | 2603880170 | Burkholderiales A2 | Isolate | Unclassified |
| 162 | 8025658853 | Caballeronia temeraria LZ065 | Isolate | Coreidae |
| 163 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 164 | 8069770227 | Caballeronia sp. LZ019 | Isolate | Coreidae |
| 165 | 8101994502 | Caballeronia sp. ATUFL_F2_KS42 | Isolate | Coreidae |
| 166 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 167 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 168 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
| 169 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 170 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 171 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 172 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466730_004980 | 3300042625 | Bacteria | 12460 |
| 2 | Ga0466730_006211 | 3300042625 | Bacteria | 162700 |
| 3 | Ga0466730_013812 | 3300042625 | Bacteria | 185537 |
| 4 | Ga0466701_023273 | 3300042598 | Bacteria | 99476 |
| 5 | Ga0466701_089863 | 3300042598 | Unclassified | 48983 |
| 6 | JGI24705J35276_12212159 | 3300002504 | Bacteria | 1880 |
| 7 | CVPL010W_10000595 | 3300002931 | Bacteria | 39550 |
| 8 | CVPL010W_10021846 | 3300002931 | Unclassified | 3487 |
| 9 | Ga0102740_1000297 | 3300007140 | Bacteria | 14095 |
| 10 | Ga0103264_1035007 | 3300007188 | Bacteria | 2242 |
| 11 | Ga0160472_101025 | 3300012839 | Bacteria | 9966 |
| 12 | Ga0160445_104718 | 3300012847 | Bacteria | 2444 |
| 13 | Ga0466657_266916 | 3300042582 | Bacteria | 12515 |
| 14 | Ga0466724_08914 | 3300042649 | Unclassified | 5619 |
| 15 | Ga0466701_077554 | 3300042598 | Bacteria | 50492 |
| 16 | Ga0466701_090690 | 3300042598 | Bacteria | 1827 |
| 17 | CVPL010W_10001027 | 3300002931 | Bacteria | 31990 |
| 18 | CVPL005L_10000278 | 3300002938 | Bacteria | 72520 |
| 19 | CVPL005L_10001679 | 3300002938 | Bacteria | 25571 |
| 20 | CVPL005L_10035311 | 3300002938 | Bacteria | 1416 |
| 21 | Ga0102737_1000958 | 3300007142 | Bacteria | 8619 |
| 22 | Ga0103264_1000227 | 3300007188 | Bacteria | 31935 |
| 23 | Ga0103267_1000233 | 3300007190 | Bacteria | 38446 |
| 24 | Ga0103268_1000275 | 3300007192 | Bacteria | 16926 |
| 25 | Ga0123355_10027435 | 3300009826 | Unclassified | 9197 |
| 26 | Ga0466724_15499 | 3300042649 | Bacteria | 16617 |
| 27 | Ga0103266_1000005 | 3300007067 | Bacteria | 128947 |
| 28 | Ga0102739_1000814 | 3300007095 | Bacteria | 5577 |
| 29 | Ga0102737_1001073 | 3300007142 | Bacteria | 8007 |
| 30 | Ga0102737_1001446 | 3300007142 | Bacteria | 6608 |
| 31 | Ga0104019_1002433 | 3300007150 | Bacteria | 10232 |
| 32 | Ga0103264_1000338 | 3300007188 | Bacteria | 25213 |
| 33 | Ga0466657_373156 | 3300042582 | Bacteria | 2104 |
| 34 | Ga0123355_10015288 | 3300009826 | Bacteria | 12053 |
| 35 | Ga0123355_10025730 | 3300009826 | Bacteria | 9477 |
| 36 | Ga0123356_10333363 | 3300010049 | Bacteria | 1635 |
| 37 | Ga0466734_022984 | 3300042623 | Bacteria | 1485 |
| 38 | JGI24705J35276_12234769 | 3300002504 | Bacteria | 5827 |
| 39 | JGI24705J35276_12238669 | 3300002504 | Bacteria | 35130 |
| 40 | Ga0103266_1009695 | 3300007067 | Bacteria | 1152 |
| 41 | Ga0103264_1001030 | 3300007188 | Bacteria | 20904 |
| 42 | Ga0160446_100069 | 3300012835 | Bacteria | 102438 |
| 43 | Ga0160466_103487 | 3300012809 | Bacteria | 2563 |
| 44 | Ga0466697_107841 | 3300042611 | Bacteria | 2689 |
| 45 | Ga0466724_16999 | 3300042649 | Bacteria | 89252 |
| 46 | CVPL010W_10031233 | 3300002931 | Unclassified | 2701 |
| 47 | Ga0102738_1000160 | 3300007141 | Bacteria | 17480 |
| 48 | Ga0160435_1001714 | 3300012857 | Unclassified | 5457 |
| 49 | Ga0123357_10134892 | 3300009784 | Bacteria | 3057 |
| 50 | Ga0160471_100189 | 3300012812 | Unclassified | 22258 |
| 51 | Ga0466724_21244 | 3300042649 | Bacteria | 100436 |
| 52 | Ga0466724_64082 | 3300042649 | Bacteria | 15086 |
| 53 | Ga0466725_196415 | 3300042654 | Bacteria | 6965 |
| 54 | Ga0466701_043106 | 3300042598 | Bacteria | 13854 |
| 55 | JGI24705J35276_12238731 | 3300002504 | Bacteria | 47180 |
| 56 | CVPL005W_1001402 | 3300002934 | Bacteria | 6426 |
| 57 | CVPL005L_10000178 | 3300002938 | Bacteria | 114224 |
| 58 | CVPL005L_10005240 | 3300002938 | Unclassified | 17096 |
| 59 | Ga0103263_100759 | 3300007042 | Unclassified | 4391 |
| 60 | Ga0102739_1000527 | 3300007095 | Bacteria | 7575 |
| 61 | Ga0123357_10000186 | 3300009784 | Bacteria | 57771 |
| 62 | Ga0160467_100005 | 3300012829 | Bacteria | 690767 |
| 63 | Ga0160459_100089 | 3300012831 | Bacteria | 102263 |
| 64 | Ga0160435_1019244 | 3300012857 | Unclassified | 1238 |
| 65 | Ga0123356_10017879 | 3300010049 | Bacteria | 6734 |
| 66 | Ga0466724_13423 | 3300042649 | Bacteria | 1529 |
| 67 | Ga0466725_381753 | 3300042654 | Bacteria | 1907 |
| 68 | CVPL010W_10011659 | 3300002931 | Unclassified | 7246 |
| 69 | CVPL010W_10022335 | 3300002931 | Bacteria | 5347 |
| 70 | Ga0102734_1001974 | 3300007129 | Bacteria | 4955 |
| 71 | Ga0103260_1004856 | 3300007139 | Unclassified | 2021 |
| 72 | Ga0160456_100090 | 3300012820 | Unclassified | 112927 |
| 73 | Ga0160443_100050 | 3300012848 | Bacteria | 249589 |
| 74 | Ga0123355_10589852 | 3300009826 | Bacteria | 1324 |
| 75 | Ga0160464_101523 | 3300012805 | Unclassified | 7417 |
| 76 | Ga0160466_100167 | 3300012809 | Bacteria | 51690 |
| 77 | Ga0466734_170208 | 3300042623 | Bacteria | 2396 |
| 78 | Ga0466730_071553 | 3300042625 | Bacteria | 12978 |
| 79 | Ga0466701_074452 | 3300042598 | Bacteria | 14431 |
| 80 | CVPL010W_10023739 | 3300002931 | Bacteria | 3880 |
| 81 | Ga0103260_1014914 | 3300007139 | Bacteria | 1085 |
| 82 | Ga0102740_1000909 | 3300007140 | Bacteria | 7985 |
| 83 | Ga0102737_1001017 | 3300007142 | Unclassified | 8301 |
| 84 | Ga0103264_1008400 | 3300007188 | Unclassified | 5012 |
| 85 | Ga0103267_1000567 | 3300007190 | Bacteria | 10911 |
| 86 | Ga0160472_100015 | 3300012839 | Bacteria | 403883 |
| 87 | Ga0160472_106883 | 3300012839 | Bacteria | 1651 |
| 88 | Ga0160447_101859 | 3300012849 | Bacteria | 7840 |
| 89 | Ga0466657_016635 | 3300042582 | Bacteria | 9094 |
| 90 | Ga0123356_10529826 | 3300010049 | Bacteria | 1337 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00756 | Esterase | Putative esterase | 75 | 328 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.