Protein Family IF01848
Metagenome
Isolate
119
Members
88
Samples
86
Scaffolds
309.37
Avg Length
Representative Sequence
- ID
- 3300007188|Ga0103264_1000281|Ga0103264_100028111
- Length
- 336 aa
- Sequence
- MIRPSLQAPNHVVLIRPHHFDLNPLTAKDNSFQSMEDHSSAQFLAQKAYEEVTEMAASLTRVGVKVHLFEDESCDLPDSVFPNNWFSTHPGGHIAIYPMFSPNRRGERRSDIIEMLKREYRVQDVVDYSGLEHDQLYLEGTGAMVLDHIGNIAYAARSNRTNEVILERFCTHFNFEPMVFDAVDEAGKPIYHTNVMMCIATDFALFGADLVTDARRRGEIIERLEETGREVIILTRAQIGDFAGNAIELEGAQGRVLALSCRAFSALGSDQKKQIEKSAQCLPISVPTIELAGGSVRCMCAGIHLAKRKTDTPNLFYQEIGYNGYDMQKIGAISA*
Sample Types
Isolate
27.7%
Metagenome
72.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
15.1%
Kalotermitidae
14.0%
Unclassified
11.6%
Drosophilidae
11.6%
Culicidae
8.1%
Formicidae
5.8%
Apidae
4.7%
Armadillidiidae
4.7%
Elmidae
4.7%
Termopsidae
4.7%
Blattidae
3.5%
Rhinotermitidae
2.3%
Nephropidae
2.3%
Hydrophilidae
1.2%
Daphniidae
1.2%
Hodotermitidae
1.2%
Cambaridae
1.2%
Siricidae
1.2%
Curculionidae
1.2%
Taxonomy
Archaea
0
Bacteria
115
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2785510743 | Apibacter sp. ESL0404 | Isolate | Apidae |
| 2 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 3 | 2873776654 | Pedobacter sp. HDW13 | Isolate | Hydrophilidae |
| 4 | 2902916284 | Pseudoalteromonas rubra S1946 | Isolate | Unclassified |
| 5 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 6 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 7 | 8100534375 | Gluconobacter sp. Dm-74 | Isolate | Drosophilidae |
| 8 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 9 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 10 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 11 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 12 | 2556921669 | Shinella sp. DD12 | Isolate | Daphniidae |
| 13 | 2864822740 | Chryseobacterium shigense S00064 | Isolate | Elmidae |
| 14 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 15 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 16 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 17 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 18 | 8067598439 | Gluconobacter wancherniae Dm-17 | Isolate | Drosophilidae |
| 19 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 20 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 21 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 22 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 23 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 24 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 25 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 26 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 27 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 28 | 2556921622 | Terasakiella pusilla DSM 6293 | Isolate | Unclassified |
| 29 | 2597490292 | Acetobacter malorum DmCS_005 | Isolate | Drosophilidae |
| 30 | 8068953321 | Bartonella apihabitans M0190 | Isolate | Apidae |
| 31 | 8100531325 | Gluconobacter sp. Dm-73 | Isolate | Drosophilidae |
| 32 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 33 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 34 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 35 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 36 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 37 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 38 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 39 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 40 | 2820751898 | Unclassified Bacteroidetes Nc150P4bin22 | Isolate | Unclassified |
| 41 | 2864831662 | Chryseobacterium sediminis S00068 | Isolate | Elmidae |
| 42 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 43 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 44 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 45 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 46 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 47 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 48 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 49 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 50 | 2921902974 | Chryseobacterium sp. cx-624 | Isolate | Cambaridae |
| 51 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 52 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 53 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 54 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 55 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 56 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 57 | 2718218155 | Flavobacteriaceae bacterium UJ101 | Isolate | |
| 58 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 59 | 8100528075 | Gluconobacter sp. Dm-44 | Isolate | Drosophilidae |
| 60 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 61 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 62 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 63 | 2687453786 | Chryseobacterium culicis DSM 23031 | Isolate | Unclassified |
| 64 | 2832298047 | Apibacter sp. wkB309 | Isolate | Apidae |
| 65 | 2839192570 | Gluconobacter sp. DsW_056 | Isolate | Drosophilidae |
| 66 | 2839785767 | Thalassobius sp. I31.1 | Isolate | Nephropidae |
| 67 | 2864882932 | Chryseobacterium shingense S00136 | Isolate | Elmidae |
| 68 | 2864891731 | Chryseobacterium defluvii S00151 | Isolate | Elmidae |
| 69 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 70 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 71 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 72 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 73 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 74 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 75 | 2671180705 | Pseudoalteromonas piscicida S2040 | Isolate | Unclassified |
| 76 | 2799112231 | Apibacter sp. ESL0432 | Isolate | Unclassified |
| 77 | 2838772460 | Aquimarina sp. I32.4 | Isolate | Nephropidae |
| 78 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 79 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 80 | 8067604290 | Gluconobacter wancherniae Dm-19 | Isolate | Drosophilidae |
| 81 | 8067607133 | Gluconobacter wancherniae Dm-15 | Isolate | Drosophilidae |
| 82 | 3007478678 | Pseudomonas sp. S37 | Isolate | Curculionidae |
| 83 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 84 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 85 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 86 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 87 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 88 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0160448_101132 | 3300012854 | Unclassified | 8776 |
| 2 | Ga0466691_042935 | 3300042593 | Bacteria | 34057 |
| 3 | Ga0466691_128204 | 3300042593 | Bacteria | 5981 |
| 4 | Ga0466696_127610 | 3300042596 | Bacteria | 8195 |
| 5 | Ga0466713_090160 | 3300042602 | Bacteria | 7437 |
| 6 | Ga0466731_295964 | 3300042622 | Bacteria | 1618 |
| 7 | Ga0466735_102789 | 3300042624 | Bacteria | 2302 |
| 8 | Ga0466735_206270 | 3300042624 | Bacteria | 2267 |
| 9 | Ga0466708_046893 | 3300042652 | Bacteria | 6208 |
| 10 | Ga0466725_394075 | 3300042654 | Bacteria | 4947 |
| 11 | Ga0466711_305768 | 3300042615 | Bacteria | 2847 |
| 12 | Ga0466715_157210 | 3300042616 | Bacteria | 20490 |
| 13 | Ga0466715_271362 | 3300042616 | Bacteria | 20266 |
| 14 | Ga0103266_1000237 | 3300007067 | Bacteria | 28899 |
| 15 | Ga0123357_10001706 | 3300009784 | Bacteria | 23690 |
| 16 | Ga0160467_101154 | 3300012829 | Bacteria | 12917 |
| 17 | Ga0160459_100008 | 3300012831 | Bacteria | 550480 |
| 18 | Ga0160446_100008 | 3300012835 | Bacteria | 357547 |
| 19 | Ga0466690_185521 | 3300042590 | Bacteria | 30034 |
| 20 | Ga0466701_035095 | 3300042598 | Bacteria | 38740 |
| 21 | Ga0466701_036040 | 3300042598 | Bacteria | 2382 |
| 22 | Ga0466716_251109 | 3300042605 | Bacteria | 15660 |
| 23 | Ga0466730_071786 | 3300042625 | Bacteria | 741189 |
| 24 | Ga0466709_195032 | 3300042648 | Bacteria | 8409 |
| 25 | Ga0466705_474341 | 3300042612 | Bacteria | 80430 |
| 26 | Ga0466710_044126 | 3300042613 | Bacteria | 1318 |
| 27 | Ga0466726_360170 | 3300042619 | Bacteria | 1861 |
| 28 | HBC_ctgsDRAFT_1003012 | 3300000333 | Bacteria | 3839 |
| 29 | Meta3P_1003208 | 3300002464 | Bacteria | 15443 |
| 30 | Ga0104050_1001166 | 3300007153 | Bacteria | 3247 |
| 31 | Ga0103264_1000281 | 3300007188 | Bacteria | 28445 |
| 32 | Ga0160472_100135 | 3300012839 | Bacteria | 113769 |
| 33 | Ga0160472_100742 | 3300012839 | Bacteria | 14933 |
| 34 | Ga0160445_100244 | 3300012847 | Bacteria | 38831 |
| 35 | Ga0466701_055175 | 3300042598 | Bacteria | 174968 |
| 36 | Ga0466706_221009 | 3300042599 | Unclassified | 3329 |
| 37 | Ga0466713_100459 | 3300042602 | Bacteria | 1831 |
| 38 | Ga0466722_267625 | 3300042609 | Bacteria | 11750 |
| 39 | Ga0160465_100061 | 3300012803 | Bacteria | 120691 |
| 40 | Ga0466696_115180 | 3300042596 | Bacteria | 8257 |
| 41 | Ga0466703_005428 | 3300042636 | Bacteria | 3506 |
| 42 | Ga0466727_086797 | 3300042655 | Bacteria | 3885 |
| 43 | Ga0466715_203254 | 3300042616 | Bacteria | 31453 |
| 44 | Ga0466715_642553 | 3300042616 | Bacteria | 44089 |
| 45 | Ga0466726_435870 | 3300042619 | Bacteria | 1742 |
| 46 | Ga0104045_1078309 | 3300007085 | Bacteria | 1412 |
| 47 | Ga0123353_10036577 | 3300010167 | Bacteria | 7691 |
| 48 | Ga0160446_100011 | 3300012835 | Bacteria | 308637 |
| 49 | Ga0466690_108349 | 3300042590 | Bacteria | 6014 |
| 50 | Ga0466692_054871 | 3300042591 | Bacteria | 17236 |
| 51 | Ga0466707_219037 | 3300042601 | Bacteria | 3777 |
| 52 | Ga0466716_316640 | 3300042605 | Bacteria | 1607 |
| 53 | Ga0466719_503930 | 3300042606 | Bacteria | 15609 |
| 54 | Ga0466721_026029 | 3300042608 | Bacteria | 13989 |
| 55 | Ga0466735_146124 | 3300042624 | Bacteria | 2767 |
| 56 | Ga0466709_396056 | 3300042648 | Bacteria | 40552 |
| 57 | Ga0466723_020525 | 3300042618 | Bacteria | 33523 |
| 58 | Ga0466723_189559 | 3300042618 | Bacteria | 7492 |
| 59 | JGI24705J35276_12232603 | 3300002504 | Bacteria | 4407 |
| 60 | Ga0123353_10002588 | 3300010167 | Bacteria | 22488 |
| 61 | Ga0160455_100036 | 3300012837 | Bacteria | 302007 |
| 62 | Ga0160460_100290 | 3300012845 | Bacteria | 38519 |
| 63 | Ga0160433_100024 | 3300012846 | Bacteria | 185997 |
| 64 | Ga0466713_063609 | 3300042602 | Bacteria | 3324 |
| 65 | Ga0466724_59158 | 3300042649 | Bacteria | 434991 |
| 66 | Ga0466711_044854 | 3300042615 | Bacteria | 14007 |
| 67 | SWWA_contig31641__length_42808___numreads_2009 | 2100351016 | Bacteria | 42808 |
| 68 | CVPL010W_10019298 | 3300002931 | Unclassified | 4112 |
| 69 | Ga0103264_1000375 | 3300007188 | Bacteria | 23633 |
| 70 | Ga0160471_100134 | 3300012812 | Bacteria | 30441 |
| 71 | Ga0160455_100894 | 3300012837 | Bacteria | 11261 |
| 72 | Ga0466690_189770 | 3300042590 | Bacteria | 24524 |
| 73 | Ga0466692_168623 | 3300042591 | Bacteria | 16909 |
| 74 | Ga0466707_347728 | 3300042601 | Bacteria | 15670 |
| 75 | Ga0466735_024187 | 3300042624 | Bacteria | 2983 |
| 76 | Ga0466703_228745 | 3300042636 | Bacteria | 3534 |
| 77 | CVPL005L_10011093 | 3300002938 | Bacteria | 7147 |
| 78 | Ga0466732_261501 | 3300042656 | Bacteria | 1471 |
| 79 | Ga0160459_100280 | 3300012831 | Unclassified | 24297 |
| 80 | Ga0160455_100184 | 3300012837 | Bacteria | 60067 |
| 81 | Ga0466714_141674 | 3300042603 | Bacteria | 2134 |
| 82 | Ga0466726_080855 | 3300042619 | Bacteria | 5750 |
| 83 | JGI24699J35502_11134090 | 3300002509 | Bacteria | 29402 |
| 84 | CVPL010L_1001086 | 3300002932 | Bacteria | 4375 |
| 85 | CVPL005L_10007943 | 3300002938 | Bacteria | 13754 |
| 86 | Ga0068302_10142186 | 3300005071 | Bacteria | 2269 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF19420 | DDAH_eukar | N,N dimethylarginine dimethylhydrolase, eukaryotic | 20 | 304 | 0.97 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.