Protein Family IF01605
Metagenome
Isolate
118
Members
62
Samples
104
Scaffolds
86.22
Avg Length
Representative Sequence
- ID
- 3300007052|Ga0102736_1010877|Ga0102736_10108772
- Length
- 96 aa
- Sequence
- MGRTGSGGLVNLQFSDHAWDDYLYWQHTDKKLVKRINLLIQEIKRDPFKGIGKPEPLRHALAGYWSRRINDEHRLVYKVNDGVLLIAAARYHYAG*
Sample Types
Isolate
11.9%
Metagenome
88.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
32.8%
Formicidae
24.6%
Unclassified
23.0%
Kalotermitidae
6.6%
Rhinotermitidae
3.3%
Termopsidae
3.3%
Cambaridae
1.6%
Cixiidae
1.6%
Passalidae
1.6%
Culicidae
1.6%
Taxonomy
Archaea
0
Bacteria
111
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 2 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 3 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 4 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 5 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 6 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 7 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 8 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 9 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 10 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 11 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 12 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 13 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 14 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 15 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 16 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 17 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 18 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 19 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 20 | 8053361298 | Streptomyces formicae 1H-GS9 | Isolate | Unclassified |
| 21 | 3003178663 | Psychrobacter fulvigenes KC-40 | Isolate | Unclassified |
| 22 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 23 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 24 | 2921902974 | Chryseobacterium sp. cx-624 | Isolate | Cambaridae |
| 25 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 26 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 27 | 2989309576 | Sporomusa termitida DSM 4440 | Isolate | Unclassified |
| 28 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 29 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 30 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 31 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 32 | 2603880165 | Burkholderiales A1 | Isolate | Unclassified |
| 33 | 2617270844 | Dyella sp. HyOG | Isolate | Cixiidae |
| 34 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 35 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 36 | 2918390780 | Glutamicibacter protophormiae DSM 20168 | Isolate | Unclassified |
| 37 | 2687453753 | Burkholderiales bacterium B_Cag25 | Isolate | Unclassified |
| 38 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 39 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 40 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 41 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 42 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 43 | 2820849606 | Unclassified Actinobacteria Lab288P3bin39 | Isolate | Unclassified |
| 44 | 2820926697 | Unclassified Actinobacteria Emb289P3bin125 | Isolate | Unclassified |
| 45 | 2820042117 | Unclassified Proteobacteria Th196P4bin58 | Isolate | Unclassified |
| 46 | 2820132692 | Unclassified Proteobacteria Emb289P3bin76 | Isolate | Unclassified |
| 47 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 48 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 49 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 50 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 51 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 52 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 53 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 54 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 55 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 56 | 2820842553 | Unclassified Actinobacteria Lab288P4bin104 | Isolate | Unclassified |
| 57 | 2648501628 | Xanthomonas sp. Cag60 | Isolate | Unclassified |
| 58 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 59 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 60 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 61 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 62 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0102740_1000092 | 3300007140 | Bacteria | 22206 |
| 2 | Ga0102738_1080005 | 3300007141 | Bacteria | 536 |
| 3 | Ga0103264_1012991 | 3300007188 | Bacteria | 4088 |
| 4 | Ga0103268_1001661 | 3300007192 | Bacteria | 5345 |
| 5 | Ga0466719_202450 | 3300042606 | Bacteria | 1882 |
| 6 | Ga0123356_10754902 | 3300010049 | Bacteria | 1143 |
| 7 | Ga0123353_10000599 | 3300010167 | Bacteria | 44152 |
| 8 | Ga0123353_10002607 | 3300010167 | Bacteria | 22444 |
| 9 | Ga0466657_352476 | 3300042582 | Bacteria | 5469 |
| 10 | Ga0466703_338701 | 3300042636 | Bacteria | 1011 |
| 11 | Ga0072941_1160076 | 3300005201 | Bacteria | 5083 |
| 12 | Ga0102735_1010944 | 3300007080 | Bacteria | 1150 |
| 13 | Ga0103267_1001062 | 3300007190 | Bacteria | 8918 |
| 14 | Ga0466657_114360 | 3300042582 | Bacteria | 4223 |
| 15 | Ga0466729_311235 | 3300042621 | Bacteria | 3920 |
| 16 | Ga0466702_172475 | 3300042635 | Bacteria | 2387 |
| 17 | Ga0466725_346936 | 3300042654 | Unclassified | 3041 |
| 18 | Ga0466710_103652 | 3300042613 | Bacteria | 6069 |
| 19 | Ga0466726_150774 | 3300042619 | Bacteria | 3219 |
| 20 | Ga0072940_1024429 | 3300005200 | Bacteria | 2538 |
| 21 | Ga0102736_1002160 | 3300007052 | Bacteria | 3193 |
| 22 | Ga0102739_1007320 | 3300007095 | Bacteria | 1462 |
| 23 | Ga0466657_010516 | 3300042582 | Bacteria | 28902 |
| 24 | Ga0466657_232299 | 3300042582 | Bacteria | 1184 |
| 25 | Ga0466695_362396 | 3300042595 | Bacteria | 2601 |
| 26 | Ga0466731_228467 | 3300042622 | Bacteria | 1206 |
| 27 | Ga0466734_112043 | 3300042623 | Bacteria | 1470 |
| 28 | Ga0466725_043576 | 3300042654 | Bacteria | 4309 |
| 29 | Ga0466710_383779 | 3300042613 | Bacteria | 1776 |
| 30 | Ga0466726_401040 | 3300042619 | Bacteria | 1440 |
| 31 | IMNBL1DRAFT_c0111063 | 3300000062 | Bacteria | 728 |
| 32 | JGI24702J35022_10032961 | 3300002462 | Bacteria | 2772 |
| 33 | CVPL010W_10000905 | 3300002931 | Bacteria | 33570 |
| 34 | Ga0103265_1005009 | 3300007068 | Bacteria | 2618 |
| 35 | Ga0103265_1009515 | 3300007068 | Unclassified | 1274 |
| 36 | Ga0102740_1001822 | 3300007140 | Bacteria | 5183 |
| 37 | Ga0102737_1001176 | 3300007142 | Bacteria | 7612 |
| 38 | Ga0466701_088537 | 3300042598 | Bacteria | 2566 |
| 39 | Ga0466713_089892 | 3300042602 | Bacteria | 53003 |
| 40 | Ga0466722_172017 | 3300042609 | Bacteria | 1273 |
| 41 | Ga0123356_10019408 | 3300010049 | Bacteria | 6443 |
| 42 | Ga0123353_11908665 | 3300010167 | Bacteria | 732 |
| 43 | Ga0123354_10124372 | 3300010882 | Bacteria | 3306 |
| 44 | Ga0466657_044496 | 3300042582 | Bacteria | 106333 |
| 45 | Ga0466657_119652 | 3300042582 | Bacteria | 1204 |
| 46 | Ga0466699_057221 | 3300042597 | Bacteria | 1088 |
| 47 | Ga0466734_094552 | 3300042623 | Bacteria | 1530 |
| 48 | Ga0466725_228687 | 3300042654 | Bacteria | 2273 |
| 49 | Ga0466726_348836 | 3300042619 | Bacteria | 1497 |
| 50 | JGI24702J35022_10001279 | 3300002462 | Bacteria | 15674 |
| 51 | Ga0102739_1009984 | 3300007095 | Bacteria | 1232 |
| 52 | Ga0102740_1022324 | 3300007140 | Bacteria | 969 |
| 53 | Ga0102738_1000010 | 3300007141 | Bacteria | 107934 |
| 54 | Ga0103268_1001316 | 3300007192 | Bacteria | 6289 |
| 55 | Ga0466713_083367 | 3300042602 | Bacteria | 3479 |
| 56 | Ga0123357_10251995 | 3300009784 | Bacteria | 1886 |
| 57 | Ga0123353_11210560 | 3300010167 | Bacteria | 990 |
| 58 | Ga0466693_266499 | 3300042592 | Bacteria | 6267 |
| 59 | Ga0466725_274949 | 3300042654 | Bacteria | 2689 |
| 60 | Ga0466710_297239 | 3300042613 | Bacteria | 2710 |
| 61 | Ga0466697_164654 | 3300042611 | Bacteria | 1131 |
| 62 | Ga0466733_000755 | 3300042659 | Bacteria | 8197 |
| 63 | Ga0102735_1005848 | 3300007080 | Bacteria | 2243 |
| 64 | Ga0103261_1000583 | 3300007083 | Bacteria | 5486 |
| 65 | Ga0102740_1003878 | 3300007140 | Bacteria | 3083 |
| 66 | Ga0102737_1019195 | 3300007142 | Bacteria | 1073 |
| 67 | Ga0103264_1001163 | 3300007188 | Bacteria | 11640 |
| 68 | Ga0103267_1110772 | 3300007190 | Unclassified | 727 |
| 69 | Ga0466707_026611 | 3300042601 | Bacteria | 2513 |
| 70 | Ga0123357_10255274 | 3300009784 | Bacteria | 1866 |
| 71 | Ga0123356_10000068 | 3300010049 | Bacteria | 108740 |
| 72 | Ga0466702_220863 | 3300042635 | Bacteria | 1067 |
| 73 | Ga0466725_299116 | 3300042654 | Bacteria | 1162 |
| 74 | Ga0466710_166029 | 3300042613 | Bacteria | 1774 |
| 75 | JGI24702J35022_10017832 | 3300002462 | Bacteria | 3877 |
| 76 | Ga0102736_1010877 | 3300007052 | Bacteria | 1044 |
| 77 | Ga0103266_1001435 | 3300007067 | Bacteria | 4066 |
| 78 | Ga0103260_1028852 | 3300007139 | Bacteria | 827 |
| 79 | Ga0102740_1001614 | 3300007140 | Unclassified | 5591 |
| 80 | Ga0102740_1002312 | 3300007140 | Unclassified | 4427 |
| 81 | Ga0102738_1064173 | 3300007141 | Bacteria | 592 |
| 82 | Ga0102737_1017963 | 3300007142 | Bacteria | 1112 |
| 83 | Ga0466729_293097 | 3300042621 | Bacteria | 3201 |
| 84 | Ga0466735_007172 | 3300042624 | Bacteria | 1867 |
| 85 | Ga0466724_12799 | 3300042649 | Bacteria | 5715 |
| 86 | Ga0466725_129139 | 3300042654 | Bacteria | 1952 |
| 87 | Ga0466725_181644 | 3300042654 | Bacteria | 1140 |
| 88 | Ga0466726_372613 | 3300042619 | Bacteria | 1068 |
| 89 | JGI24702J35022_10017544 | 3300002462 | Bacteria | 3910 |
| 90 | Ga0103263_107158 | 3300007042 | Bacteria | 1208 |
| 91 | Ga0103261_1009598 | 3300007083 | Unclassified | 1357 |
| 92 | Ga0103264_1000413 | 3300007188 | Bacteria | 27206 |
| 93 | Ga0466707_075185 | 3300042601 | Bacteria | 1958 |
| 94 | Ga0466713_091379 | 3300042602 | Bacteria | 2484 |
| 95 | Ga0466722_160963 | 3300042609 | Bacteria | 1156 |
| 96 | Ga0123355_10738121 | 3300009826 | Bacteria | 1118 |
| 97 | Ga0123356_10916002 | 3300010049 | Bacteria | 1048 |
| 98 | Ga0123353_11122768 | 3300010167 | Bacteria | 1041 |
| 99 | Ga0160470_102869 | 3300012813 | Bacteria | 3028 |
| 100 | Ga0466704_084612 | 3300042643 | Bacteria | 8649 |
| 101 | Ga0466725_443515 | 3300042654 | Unclassified | 2438 |
| 102 | Ga0466710_222850 | 3300042613 | Bacteria | 14040 |
| 103 | Ga0466710_251221 | 3300042613 | Bacteria | 2506 |
| 104 | Ga0466711_194435 | 3300042615 | Bacteria | 4568 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF06769 | YoeB_toxin | YoeB-like toxin of bacterial type II toxin-antitoxin system | 14 | 93 | 0.99 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.