Protein Family IF01387
Metagenome
Isolate
143
Members
45
Samples
138
Scaffolds
97.36
Avg Length
Representative Sequence
- ID
- 3300005201|Ga0072941_1794914|Ga0072941_17949141
- Length
- 107 aa
- Sequence
- MYDIQFTKQAKKDAVLVEQAGLKPKAAELISIVKANPFQNPPEYESLKGDRKGSYSRRINKQHRFVYQVIPNTKNLMDENDVPYEGIVKIIRMWTHYDLPRKHNRP*
Sample Types
Isolate
3.5%
Metagenome
96.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
61.4%
Unclassified
13.6%
Kalotermitidae
13.6%
Rhinotermitidae
6.8%
Termopsidae
4.5%
Taxonomy
Archaea
1
Bacteria
116
Eukaryota
0
Viruses
0
Unclassified
26
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820333861 | Unclassified Firmicutes Nt197P3bin72 | Isolate | Unclassified |
| 2 | 2820004052 | Unclassified Synergistetes Nt197P3bin25 | Isolate | Unclassified |
| 3 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 4 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 5 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 6 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 7 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 8 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 9 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 10 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 11 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 12 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 13 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 14 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 15 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 16 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 17 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 18 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 19 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 20 | 2820420508 | Unclassified Firmicutes Lab288P3bin68 | Isolate | Unclassified |
| 21 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 22 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 23 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 24 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 25 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 26 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 27 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 28 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 29 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 30 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 31 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 32 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 33 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 34 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 35 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 36 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 37 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 38 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 39 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 40 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 41 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 42 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 43 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 44 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 45 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123357_10372046 | 3300009784 | Bacteria | 1338 |
| 2 | Ga0123355_10172252 | 3300009826 | Bacteria | 3232 |
| 3 | Ga0123355_10541663 | 3300009826 | Bacteria | 1412 |
| 4 | Ga0123355_11450914 | 3300009826 | Bacteria | 674 |
| 5 | Ga0123356_10194204 | 3300010049 | Unclassified | 2064 |
| 6 | Ga0123356_11847799 | 3300010049 | Bacteria | 751 |
| 7 | Ga0123353_12087144 | 3300010167 | Bacteria | 690 |
| 8 | Ga0466694_203330 | 3300042594 | Bacteria | 2129 |
| 9 | Ga0466712_144421 | 3300042614 | Bacteria | 3848 |
| 10 | Ga0466718_108096 | 3300042617 | Bacteria | 1016 |
| 11 | Ga0466726_269790 | 3300042619 | Bacteria | 1204 |
| 12 | Ga0466726_310103 | 3300042619 | Bacteria | 1087 |
| 13 | JGI24698J34947_10059833 | 3300002449 | Bacteria | 1881 |
| 14 | JGI24695J34938_10018926 | 3300002450 | Unclassified | 3427 |
| 15 | Ga0466734_069847 | 3300042623 | Bacteria | 1019 |
| 16 | Ga0466704_191874 | 3300042643 | Bacteria | 6443 |
| 17 | Ga0466727_163043 | 3300042655 | Bacteria | 1475 |
| 18 | Ga0466720_203643 | 3300042607 | Bacteria | 3841 |
| 19 | Ga0123355_10452587 | 3300009826 | Unclassified | 1617 |
| 20 | Ga0123356_10694638 | 3300010049 | Bacteria | 1186 |
| 21 | Ga0123356_10982438 | 3300010049 | Bacteria | 1015 |
| 22 | Ga0123353_10010030 | 3300010167 | Unclassified | 13157 |
| 23 | Ga0123353_12220250 | 3300010167 | Bacteria | 663 |
| 24 | Ga0415639_165684 | 3300038395 | Bacteria | 2232 |
| 25 | AustNasuHG_c1058082 | 3300000089 | Bacteria | 767 |
| 26 | JGI24698J34947_10001140 | 3300002449 | Bacteria | 13788 |
| 27 | JGI24695J34938_10357577 | 3300002450 | Bacteria | 643 |
| 28 | JGI24705J35276_11303943 | 3300002504 | Bacteria | 503 |
| 29 | Ga0072940_1118438 | 3300005200 | Bacteria | 1175 |
| 30 | Ga0072941_1054514 | 3300005201 | Bacteria | 2484 |
| 31 | Ga0466734_024637 | 3300042623 | Unclassified | 1243 |
| 32 | Ga0466700_223818 | 3300042600 | Bacteria | 1089 |
| 33 | Ga0466717_153117 | 3300042604 | Bacteria | 2340 |
| 34 | Ga0466693_358866 | 3300042592 | Bacteria | 1255 |
| 35 | Ga0466699_440481 | 3300042597 | Bacteria | 2798 |
| 36 | Ga0466718_018815 | 3300042617 | Bacteria | 32417 |
| 37 | Ga0466718_027965 | 3300042617 | Bacteria | 1695 |
| 38 | Ga0466718_050432 | 3300042617 | Bacteria | 6234 |
| 39 | Ga0466718_118299 | 3300042617 | Unclassified | 2262 |
| 40 | Ga0466726_031484 | 3300042619 | Bacteria | 1124 |
| 41 | Ga0466729_001408 | 3300042621 | Bacteria | 1603 |
| 42 | Ga0466729_147213 | 3300042621 | Bacteria | 2525 |
| 43 | JGI24698J34947_10050405 | 3300002449 | Unclassified | 2100 |
| 44 | JGI24698J34947_10145941 | 3300002449 | Bacteria | 989 |
| 45 | JGI24698J34947_10192374 | 3300002449 | Bacteria | 806 |
| 46 | JGI24695J34938_10047179 | 3300002450 | Bacteria | 1903 |
| 47 | Ga0072941_1054515 | 3300005201 | Unclassified | 1486 |
| 48 | Ga0466704_177222 | 3300042643 | Unclassified | 1662 |
| 49 | Ga0466720_174121 | 3300042607 | Bacteria | 15670 |
| 50 | Ga0466705_291856 | 3300042612 | Bacteria | 5018 |
| 51 | Ga0123356_10000651 | 3300010049 | Bacteria | 38307 |
| 52 | Ga0123356_10370690 | 3300010049 | Bacteria | 1562 |
| 53 | Ga0123356_10911842 | 3300010049 | Bacteria | 1050 |
| 54 | Ga0123356_12624909 | 3300010049 | Unclassified | 631 |
| 55 | Ga0123353_10374970 | 3300010167 | Bacteria | 2131 |
| 56 | Ga0123353_11120202 | 3300010167 | Bacteria | 1043 |
| 57 | Ga0123353_12192839 | 3300010167 | Unclassified | 669 |
| 58 | Ga0466728_224818 | 3300042620 | Bacteria | 10232 |
| 59 | AustNasuHG_c1047885 | 3300000089 | Unclassified | 947 |
| 60 | JGI24698J34947_10168669 | 3300002449 | Bacteria | 889 |
| 61 | JGI24695J34938_10135154 | 3300002450 | Bacteria | 1006 |
| 62 | JGI24702J35022_10176049 | 3300002462 | Bacteria | 1213 |
| 63 | Ga0072941_1009325 | 3300005201 | Bacteria | 25187 |
| 64 | Ga0466719_506628 | 3300042606 | Bacteria | 1998 |
| 65 | Ga0466722_095052 | 3300042609 | Bacteria | 9352 |
| 66 | Ga0466733_016409 | 3300042659 | Bacteria | 1453 |
| 67 | Ga0123355_10000967 | 3300009826 | Bacteria | 39727 |
| 68 | Ga0123355_10709848 | 3300009826 | Bacteria | 1151 |
| 69 | Ga0123356_10418909 | 3300010049 | Unclassified | 1481 |
| 70 | Ga0123356_10978117 | 3300010049 | Bacteria | 1017 |
| 71 | Ga0123353_10052773 | 3300010167 | Bacteria | 6495 |
| 72 | Ga0123353_11063830 | 3300010167 | Bacteria | 1079 |
| 73 | Ga0415639_012600 | 3300038395 | Bacteria | 1762 |
| 74 | Ga0466694_109835 | 3300042594 | Bacteria | 1331 |
| 75 | Ga0466699_140334 | 3300042597 | Bacteria | 1612 |
| 76 | Ga0466712_191029 | 3300042614 | Bacteria | 4997 |
| 77 | Ga0466715_218664 | 3300042616 | Bacteria | 1240 |
| 78 | Ga0466718_002631 | 3300042617 | Bacteria | 1192 |
| 79 | Ga0466726_481127 | 3300042619 | Bacteria | 1211 |
| 80 | JGI24698J34947_10358640 | 3300002449 | Bacteria | 508 |
| 81 | JGI24695J34938_10001753 | 3300002450 | Unclassified | 17938 |
| 82 | Ga0072940_1238572 | 3300005200 | Bacteria | 1568 |
| 83 | Ga0072941_1054513 | 3300005201 | Unclassified | 523 |
| 84 | Ga0072941_1225918 | 3300005201 | Bacteria | 2760 |
| 85 | Ga0466704_361081 | 3300042643 | Bacteria | 1477 |
| 86 | Ga0466714_121907 | 3300042603 | Bacteria | 1363 |
| 87 | Ga0466705_250297 | 3300042612 | Bacteria | 7653 |
| 88 | Ga0123357_10208889 | 3300009784 | Bacteria | 2200 |
| 89 | Ga0123355_10757087 | 3300009826 | Bacteria | 1096 |
| 90 | Ga0123355_10804108 | 3300009826 | Archaea | 1047 |
| 91 | Ga0123355_11850605 | 3300009826 | Bacteria | 567 |
| 92 | Ga0123356_10005342 | 3300010049 | Bacteria | 13095 |
| 93 | Ga0123356_12133873 | 3300010049 | Unclassified | 700 |
| 94 | Ga0123353_10698132 | 3300010167 | Bacteria | 1425 |
| 95 | Ga0123353_11356143 | 3300010167 | Bacteria | 918 |
| 96 | Ga0123353_12867250 | 3300010167 | Bacteria | 563 |
| 97 | Ga0466699_003150 | 3300042597 | Bacteria | 5581 |
| 98 | Ga0466712_015970 | 3300042614 | Bacteria | 7228 |
| 99 | Ga0466715_538914 | 3300042616 | Bacteria | 12983 |
| 100 | JGI24695J34938_10025209 | 3300002450 | Unclassified | 2846 |
| 101 | JGI24702J35022_10045293 | 3300002462 | Unclassified | 2344 |
| 102 | Ga0072940_1147918 | 3300005200 | Bacteria | 2007 |
| 103 | Ga0466722_104404 | 3300042609 | Bacteria | 2782 |
| 104 | Ga0123357_10224215 | 3300009784 | Bacteria | 2078 |
| 105 | Ga0123355_10566507 | 3300009826 | Unclassified | 1365 |
| 106 | Ga0123355_10831129 | 3300009826 | Bacteria | 1022 |
| 107 | Ga0123356_10185990 | 3300010049 | Bacteria | 2104 |
| 108 | Ga0123353_10017109 | 3300010167 | Bacteria | 10635 |
| 109 | Ga0123353_10766937 | 3300010167 | Unclassified | 1339 |
| 110 | Ga0123353_10820912 | 3300010167 | Bacteria | 1280 |
| 111 | Ga0123354_10576414 | 3300010882 | Bacteria | 836 |
| 112 | Ga0466692_144945 | 3300042591 | Bacteria | 1240 |
| 113 | Ga0466723_261431 | 3300042618 | Bacteria | 13543 |
| 114 | JGI24702J35022_10615968 | 3300002462 | Bacteria | 672 |
| 115 | JGI24696J40584_12943999 | 3300002834 | Unclassified | 1795 |
| 116 | Ga0072941_1323716 | 3300005201 | Bacteria | 2004 |
| 117 | Ga0466729_257758 | 3300042621 | Bacteria | 1005 |
| 118 | Ga0466707_120173 | 3300042601 | Unclassified | 1491 |
| 119 | Ga0466719_045192 | 3300042606 | Bacteria | 14151 |
| 120 | Ga0466705_263910 | 3300042612 | Bacteria | 1455 |
| 121 | Ga0123355_10296165 | 3300009826 | Bacteria | 2212 |
| 122 | Ga0123355_11811207 | 3300009826 | Unclassified | 575 |
| 123 | Ga0123353_11989340 | 3300010167 | Unclassified | 712 |
| 124 | Ga0123353_12594380 | 3300010167 | Unclassified | 600 |
| 125 | Ga0415639_119179 | 3300038395 | Bacteria | 2255 |
| 126 | Ga0466656_138251 | 3300042550 | Bacteria | 1100 |
| 127 | Ga0466693_198758 | 3300042592 | Bacteria | 1119 |
| 128 | Ga0466726_097443 | 3300042619 | Bacteria | 1747 |
| 129 | JGI24698J34947_10050413 | 3300002449 | Bacteria | 2100 |
| 130 | JGI24698J34947_10080413 | 3300002449 | Bacteria | 1531 |
| 131 | JGI24695J34938_10238187 | 3300002450 | Bacteria | 768 |
| 132 | Ga0072941_1154193 | 3300005201 | Bacteria | 797 |
| 133 | Ga0072941_1794914 | 3300005201 | Bacteria | 750 |
| 134 | Ga0466702_218207 | 3300042635 | Bacteria | 4783 |
| 135 | Ga0466707_028857 | 3300042601 | Bacteria | 1610 |
| 136 | Ga0466717_230040 | 3300042604 | Bacteria | 3535 |
| 137 | Ga0466720_040493 | 3300042607 | Bacteria | 4391 |
| 138 | Ga0466698_349994 | 3300042610 | Unclassified | 2034 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF06769 | YoeB_toxin | YoeB-like toxin of bacterial type II toxin-antitoxin system | 22 | 71 | 0.83 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.