Protein Family IF01368
Metagenome
Isolate
137
Members
48
Samples
134
Scaffolds
278.62
Avg Length
Representative Sequence
- ID
- 3300005201|Ga0072941_1243860|Ga0072941_12438602
- Length
- 329 aa
- Sequence
- MKKMFKTLHGIESFFLYPHNLLQNYEKFPFVLNFSNKCCTFVRFFITNMKQTQHFYIDVQEILREKAPHTADKTPSFVVKALSKIIHQNEINQFLKESEGATGVDFMNHAVDFFNLRFNIVGEDNLPDFDNKCIFASNHPLGGPDGISLASFLGNRYGHRIKYIVNDILYFLQPLQSIFVPVNKHGEQGRSAAKLLNDSFASEDQILTFPAGLCSRKIKGKICDLDWKKMFVVKAVEYQRNVVPVYFEAKNSRFFYAIANLRRLFKVKFNIEMLFLPHELFKIKRSKRSTFTIYFGKPIPWQTFDSSKSPQQWTDWVKQTVYNLNGKK*
Sample Types
Isolate
2.2%
Metagenome
97.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
42.6%
Kalotermitidae
29.8%
Unclassified
8.5%
Rhinotermitidae
6.4%
Termopsidae
6.4%
Blattidae
4.3%
Hodotermitidae
2.1%
Taxonomy
Archaea
0
Bacteria
130
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 2 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 3 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 4 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 11 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 12 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 13 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 14 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 15 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 16 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 17 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 18 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 19 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 20 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 21 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 22 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 23 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 24 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 25 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 26 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 27 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 28 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 29 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 30 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 31 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 32 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 33 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 34 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 35 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 36 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 37 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 38 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 39 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 40 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 41 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 42 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 43 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 44 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 45 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 46 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 47 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 48 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466690_315922 | 3300042590 | Unclassified | 1060 |
| 2 | Ga0466692_050164 | 3300042591 | Bacteria | 17757 |
| 3 | Ga0466691_103514 | 3300042593 | Bacteria | 21087 |
| 4 | Ga0466701_005269 | 3300042598 | Bacteria | 2486 |
| 5 | Ga0466731_263774 | 3300042622 | Bacteria | 2855 |
| 6 | Ga0466703_383278 | 3300042636 | Bacteria | 7909 |
| 7 | Ga0466708_028589 | 3300042652 | Bacteria | 12607 |
| 8 | Ga0466727_291191 | 3300042655 | Bacteria | 8080 |
| 9 | Ga0466706_121373 | 3300042599 | Bacteria | 45048 |
| 10 | Ga0466713_085895 | 3300042602 | Bacteria | 8607 |
| 11 | Ga0466717_172285 | 3300042604 | Bacteria | 3739 |
| 12 | Ga0466716_103170 | 3300042605 | Bacteria | 1877 |
| 13 | Ga0466722_248749 | 3300042609 | Bacteria | 1544 |
| 14 | Ga0123354_10135326 | 3300010882 | Bacteria | 3085 |
| 15 | Ga0466710_174493 | 3300042613 | Bacteria | 17548 |
| 16 | Ga0466711_347465 | 3300042615 | Unclassified | 12854 |
| 17 | Ga0466728_045596 | 3300042620 | Bacteria | 30767 |
| 18 | Ga0466690_034574 | 3300042590 | Bacteria | 15477 |
| 19 | Ga0466690_434293 | 3300042590 | Bacteria | 6161 |
| 20 | Ga0466703_027233 | 3300042636 | Bacteria | 2689 |
| 21 | Ga0466704_142532 | 3300042643 | Bacteria | 7952 |
| 22 | Ga0466704_322171 | 3300042643 | Bacteria | 8368 |
| 23 | Ga0466727_050078 | 3300042655 | Bacteria | 14037 |
| 24 | Ga0466707_054338 | 3300042601 | Bacteria | 5942 |
| 25 | Ga0466714_071171 | 3300042603 | Bacteria | 8163 |
| 26 | Ga0466719_280972 | 3300042606 | Bacteria | 5448 |
| 27 | Ga0466697_047479 | 3300042611 | Bacteria | 73888 |
| 28 | Ga0123357_10025848 | 3300009784 | Bacteria | 7925 |
| 29 | Ga0123356_10228717 | 3300010049 | Bacteria | 1922 |
| 30 | Ga0123354_10010911 | 3300010882 | Bacteria | 14018 |
| 31 | Ga0123354_10171615 | 3300010882 | Bacteria | 2520 |
| 32 | Ga0123354_10366774 | 3300010882 | Unclassified | 1262 |
| 33 | Ga0466715_307695 | 3300042616 | Bacteria | 18061 |
| 34 | Ga0466728_311970 | 3300042620 | Bacteria | 3523 |
| 35 | Ga0466729_175636 | 3300042621 | Bacteria | 14158 |
| 36 | JGI24702J35022_10008813 | 3300002462 | Bacteria | 5693 |
| 37 | Ga0068305_10104738 | 3300005083 | Bacteria | 7226 |
| 38 | Ga0068305_10109873 | 3300005083 | Bacteria | 10062 |
| 39 | Ga0068305_10284306 | 3300005083 | Bacteria | 1907 |
| 40 | Ga0123357_10002573 | 3300009784 | Bacteria | 20350 |
| 41 | Ga0466705_372178 | 3300042612 | Bacteria | 6400 |
| 42 | Ga0466704_512771 | 3300042643 | Bacteria | 9386 |
| 43 | Ga0466708_138620 | 3300042652 | Bacteria | 12149 |
| 44 | Ga0466727_137119 | 3300042655 | Bacteria | 2254 |
| 45 | Ga0466700_005213 | 3300042600 | Bacteria | 12166 |
| 46 | Ga0466707_287995 | 3300042601 | Unclassified | 3216 |
| 47 | Ga0466714_039715 | 3300042603 | Bacteria | 1270 |
| 48 | Ga0466714_159167 | 3300042603 | Bacteria | 6826 |
| 49 | Ga0466716_174213 | 3300042605 | Bacteria | 2307 |
| 50 | Ga0466716_223899 | 3300042605 | Bacteria | 2290 |
| 51 | Ga0466719_059687 | 3300042606 | Bacteria | 12859 |
| 52 | Ga0123357_10051110 | 3300009784 | Bacteria | 5590 |
| 53 | Ga0466715_357754 | 3300042616 | Bacteria | 33665 |
| 54 | Ga0466726_050555 | 3300042619 | Bacteria | 2293 |
| 55 | Ga0466726_073698 | 3300042619 | Bacteria | 5973 |
| 56 | JGI24695J34938_10071719 | 3300002450 | Bacteria | 1446 |
| 57 | Ga0068305_10033366 | 3300005083 | Bacteria | 9897 |
| 58 | Ga0466696_274193 | 3300042596 | Bacteria | 2858 |
| 59 | Ga0466696_444495 | 3300042596 | Bacteria | 11679 |
| 60 | Ga0466703_004065 | 3300042636 | Bacteria | 3948 |
| 61 | Ga0466709_279392 | 3300042648 | Bacteria | 3466 |
| 62 | Ga0466713_021200 | 3300042602 | Bacteria | 9214 |
| 63 | Ga0466717_017801 | 3300042604 | Bacteria | 1966 |
| 64 | Ga0123357_10216796 | 3300009784 | Unclassified | 2134 |
| 65 | Ga0466723_354948 | 3300042618 | Bacteria | 23912 |
| 66 | Ga0466656_113263 | 3300042550 | Bacteria | 33316 |
| 67 | Ga0466735_007097 | 3300042624 | Bacteria | 4390 |
| 68 | Ga0466703_202519 | 3300042636 | Bacteria | 22773 |
| 69 | Ga0466704_378524 | 3300042643 | Bacteria | 1141 |
| 70 | Ga0466709_376503 | 3300042648 | Bacteria | 12791 |
| 71 | Ga0466727_176346 | 3300042655 | Bacteria | 17609 |
| 72 | Ga0466713_089856 | 3300042602 | Bacteria | 11701 |
| 73 | Ga0123357_10102512 | 3300009784 | Bacteria | 3684 |
| 74 | Ga0123353_10139025 | 3300010167 | Bacteria | 3893 |
| 75 | Ga0123354_10087805 | 3300010882 | Bacteria | 4332 |
| 76 | Ga0466726_255530 | 3300042619 | Bacteria | 1020 |
| 77 | Ga0466728_168100 | 3300042620 | Bacteria | 21352 |
| 78 | JGI24699J35502_11134096 | 3300002509 | Bacteria | 30204 |
| 79 | Ga0123357_10003534 | 3300009784 | Bacteria | 17964 |
| 80 | Ga0466656_021695 | 3300042550 | Bacteria | 3322 |
| 81 | Ga0466657_322145 | 3300042582 | Bacteria | 1658 |
| 82 | Ga0466690_035961 | 3300042590 | Bacteria | 3798 |
| 83 | Ga0466704_249834 | 3300042643 | Bacteria | 14240 |
| 84 | Ga0466704_385577 | 3300042643 | Bacteria | 3104 |
| 85 | Ga0466725_461920 | 3300042654 | Bacteria | 38511 |
| 86 | Ga0466706_118381 | 3300042599 | Bacteria | 1804 |
| 87 | Ga0466713_051688 | 3300042602 | Bacteria | 6951 |
| 88 | Ga0466713_119808 | 3300042602 | Bacteria | 48294 |
| 89 | Ga0466714_068131 | 3300042603 | Bacteria | 8263 |
| 90 | Ga0466716_174456 | 3300042605 | Bacteria | 3307 |
| 91 | Ga0466719_081974 | 3300042606 | Bacteria | 6153 |
| 92 | Ga0123354_10016000 | 3300010882 | Bacteria | 11752 |
| 93 | Ga0123354_10316172 | 3300010882 | Bacteria | 1449 |
| 94 | Ga0466710_026203 | 3300042613 | Bacteria | 15115 |
| 95 | Ga0466715_030204 | 3300042616 | Bacteria | 32308 |
| 96 | Ga0466715_198412 | 3300042616 | Bacteria | 6443 |
| 97 | Ga0466723_160240 | 3300042618 | Bacteria | 6713 |
| 98 | Ga0466728_132211 | 3300042620 | Bacteria | 29619 |
| 99 | JGI24702J35022_10127382 | 3300002462 | Bacteria | 1411 |
| 100 | JGI24705J35276_12238178 | 3300002504 | Bacteria | 16911 |
| 101 | Ga0466697_254209 | 3300042611 | Bacteria | 2781 |
| 102 | Ga0466690_019839 | 3300042590 | Bacteria | 17453 |
| 103 | Ga0466696_102295 | 3300042596 | Bacteria | 4407 |
| 104 | Ga0466709_326213 | 3300042648 | Bacteria | 2816 |
| 105 | Ga0466725_036706 | 3300042654 | Bacteria | 4211 |
| 106 | Ga0466717_302323 | 3300042604 | Bacteria | 1850 |
| 107 | Ga0466716_090621 | 3300042605 | Bacteria | 10421 |
| 108 | Ga0123356_10331775 | 3300010049 | Bacteria | 1638 |
| 109 | Ga0123353_10142406 | 3300010167 | Unclassified | 3839 |
| 110 | Ga0123353_10449557 | 3300010167 | Bacteria | 1897 |
| 111 | Ga0123354_10135542 | 3300010882 | Unclassified | 3081 |
| 112 | Ga0123354_10172327 | 3300010882 | Bacteria | 2512 |
| 113 | Ga0466711_478228 | 3300042615 | Bacteria | 14896 |
| 114 | Ga0466726_149087 | 3300042619 | Bacteria | 6832 |
| 115 | JGI24702J35022_10111807 | 3300002462 | Bacteria | 1502 |
| 116 | JGI24705J35276_12144525 | 3300002504 | Bacteria | 1155 |
| 117 | Ga0072941_1243860 | 3300005201 | Bacteria | 2012 |
| 118 | Ga0072941_1564361 | 3300005201 | Bacteria | 867 |
| 119 | Ga0466697_068071 | 3300042611 | Bacteria | 1404 |
| 120 | Ga0466657_170521 | 3300042582 | Bacteria | 1120 |
| 121 | Ga0466692_064946 | 3300042591 | Bacteria | 2358 |
| 122 | Ga0466735_090148 | 3300042624 | Bacteria | 4650 |
| 123 | Ga0466703_048823 | 3300042636 | Bacteria | 16130 |
| 124 | Ga0466703_178721 | 3300042636 | Bacteria | 4856 |
| 125 | Ga0466701_093074 | 3300042598 | Bacteria | 1597 |
| 126 | Ga0466713_034207 | 3300042602 | Bacteria | 23348 |
| 127 | Ga0466698_345727 | 3300042610 | Bacteria | 4641 |
| 128 | Ga0123357_10014331 | 3300009784 | Bacteria | 10340 |
| 129 | Ga0466710_449550 | 3300042613 | Bacteria | 2146 |
| 130 | Ga0466712_196457 | 3300042614 | Bacteria | 1034 |
| 131 | Ga0466711_248904 | 3300042615 | Bacteria | 12581 |
| 132 | Ga0466711_285989 | 3300042615 | Bacteria | 7430 |
| 133 | Ga0466715_039490 | 3300042616 | Bacteria | 5544 |
| 134 | JGI24699J35502_11133304 | 3300002509 | Bacteria | 9709 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF19576 | Acyltransf_2 | Acyltransferase | 62 | 325 | 0.95 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.