Protein Family IF01360
Metagenome
Isolate
253
Members
62
Samples
239
Scaffolds
211.05
Avg Length
Representative Sequence
- ID
- 3300005201|Ga0072941_1178403|Ga0072941_11784032
- Length
- 257 aa
- Sequence
- SSAPTPRGFPAAPYCGNGRFTPKPSRTIAKYCRSILDGFGPYPYSYVMSFIRQPFRYRNVGAVYWLIGINIVVFVAMYLLGFENLRYYLSMVPLLVMRGWIWTFVTYMFIHGGFSHILFNMFALFIFGTQVERHMGSREFLLFYFVTGALAGVFSFFAYYITESYWVMLMGASGAIFAVELAYAVFFPQSIIYIWGILPLRAPVMVLGFTALELVFSFTRRSSGVAHLTHLAGFAFAWLYFLIRFRINPWRRLRSR*
Sample Types
Isolate
5.5%
Metagenome
94.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
37.7%
Unclassified
26.2%
Kalotermitidae
23.0%
Rhinotermitidae
6.6%
Termopsidae
4.9%
Blaberidae
1.6%
Taxonomy
Archaea
1
Bacteria
236
Eukaryota
0
Viruses
2
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125643 | Treponema sp. Co191P3bin45 | Isolate | Unclassified |
| 2 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 3 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 4 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 5 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 6 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 7 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 8 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 9 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 10 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 11 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 12 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 13 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 14 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 15 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 16 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 17 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 18 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 19 | 2781125681 | Treponema sp. Lab288P1bin11 | Isolate | Unclassified |
| 20 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 21 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 22 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 23 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 24 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 25 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 26 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 27 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 28 | 2781125642 | Treponema sp. Co191P1bin35 | Isolate | Unclassified |
| 29 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 30 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 31 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 32 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 33 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 34 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 35 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 36 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 37 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 38 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 39 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 40 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 41 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 42 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 43 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 44 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 45 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 46 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 47 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 48 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 49 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 50 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 51 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 52 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 53 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 54 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 55 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 56 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 57 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 58 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 59 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 60 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 61 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 62 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466712_162807 | 3300042614 | Bacteria | 18281 |
| 2 | Ga0466723_066122 | 3300042618 | Bacteria | 9842 |
| 3 | Ga0466723_142274 | 3300042618 | Bacteria | 1718 |
| 4 | Ga0466723_347688 | 3300042618 | Bacteria | 7039 |
| 5 | Ga0466726_164959 | 3300042619 | Bacteria | 1650 |
| 6 | Ga0466726_207220 | 3300042619 | Bacteria | 2778 |
| 7 | Ga0466726_316804 | 3300042619 | Bacteria | 1644 |
| 8 | Ga0466691_216566 | 3300042593 | Bacteria | 11287 |
| 9 | Ga0466696_031846 | 3300042596 | Bacteria | 6775 |
| 10 | Ga0466699_005244 | 3300042597 | Bacteria | 4110 |
| 11 | Ga0466699_140710 | 3300042597 | Bacteria | 1699 |
| 12 | Ga0466699_156293 | 3300042597 | Bacteria | 1022 |
| 13 | Ga0466714_121817 | 3300042603 | Viruses | 1583 |
| 14 | Ga0466716_195313 | 3300042605 | Bacteria | 2168 |
| 15 | Ga0466719_034131 | 3300042606 | Bacteria | 7735 |
| 16 | Ga0123356_10527685 | 3300010049 | Unclassified | 1339 |
| 17 | Ga0123356_10758667 | 3300010049 | Bacteria | 1140 |
| 18 | Ga0466735_090036 | 3300042624 | Bacteria | 5238 |
| 19 | Ga0466703_084317 | 3300042636 | Bacteria | 8963 |
| 20 | Ga0466703_240074 | 3300042636 | Bacteria | 5108 |
| 21 | Ga0466709_389811 | 3300042648 | Bacteria | 11358 |
| 22 | Ga0466708_240784 | 3300042652 | Bacteria | 13374 |
| 23 | Ga0466708_279988 | 3300042652 | Bacteria | 1375 |
| 24 | Ga0466727_291494 | 3300042655 | Bacteria | 1464 |
| 25 | JGI24698J34947_10033111 | 3300002449 | Viruses | 2712 |
| 26 | JGI24698J34947_10064455 | 3300002449 | Bacteria | 1791 |
| 27 | JGI24695J34938_10000248 | 3300002450 | Bacteria | 52089 |
| 28 | JGI24695J34938_10099481 | 3300002450 | Bacteria | 1189 |
| 29 | Ga0072940_1032268 | 3300005200 | Bacteria | 4366 |
| 30 | Ga0072940_1063746 | 3300005200 | Bacteria | 1886 |
| 31 | Ga0072941_1031302 | 3300005201 | Unclassified | 10154 |
| 32 | Ga0466705_204053 | 3300042612 | Bacteria | 3344 |
| 33 | Ga0466732_079256 | 3300042656 | Bacteria | 2045 |
| 34 | Ga0466712_235608 | 3300042614 | Bacteria | 3955 |
| 35 | Ga0466718_062522 | 3300042617 | Bacteria | 10003 |
| 36 | Ga0466728_047202 | 3300042620 | Bacteria | 3993 |
| 37 | Ga0466728_471020 | 3300042620 | Bacteria | 3440 |
| 38 | Ga0466690_053453 | 3300042590 | Bacteria | 34743 |
| 39 | Ga0466690_258602 | 3300042590 | Bacteria | 3273 |
| 40 | Ga0466690_290810 | 3300042590 | Bacteria | 1724 |
| 41 | Ga0466693_231330 | 3300042592 | Bacteria | 1028 |
| 42 | Ga0466694_105065 | 3300042594 | Bacteria | 2641 |
| 43 | Ga0466696_198841 | 3300042596 | Bacteria | 12016 |
| 44 | Ga0466696_205287 | 3300042596 | Bacteria | 2166 |
| 45 | Ga0466699_194618 | 3300042597 | Bacteria | 2396 |
| 46 | Ga0466700_236834 | 3300042600 | Bacteria | 1950 |
| 47 | Ga0466707_134960 | 3300042601 | Bacteria | 10352 |
| 48 | Ga0466719_140155 | 3300042606 | Bacteria | 1183 |
| 49 | Ga0123355_10098309 | 3300009826 | Bacteria | 4617 |
| 50 | Ga0123353_10400321 | 3300010167 | Bacteria | 2044 |
| 51 | Ga0466704_167337 | 3300042643 | Bacteria | 117281 |
| 52 | Ga0466709_122577 | 3300042648 | Bacteria | 12130 |
| 53 | Ga0068305_10590498 | 3300005083 | Bacteria | 6683 |
| 54 | Ga0072941_1038706 | 3300005201 | Bacteria | 2706 |
| 55 | Ga0466705_147202 | 3300042612 | Bacteria | 1081 |
| 56 | Ga0466712_159192 | 3300042614 | Bacteria | 9241 |
| 57 | Ga0466711_447405 | 3300042615 | Bacteria | 11641 |
| 58 | Ga0466715_266017 | 3300042616 | Bacteria | 5940 |
| 59 | Ga0466690_069308 | 3300042590 | Bacteria | 2094 |
| 60 | Ga0466692_064752 | 3300042591 | Bacteria | 30509 |
| 61 | Ga0466693_313860 | 3300042592 | Bacteria | 1208 |
| 62 | Ga0466691_007633 | 3300042593 | Bacteria | 3063 |
| 63 | Ga0466699_053392 | 3300042597 | Bacteria | 12258 |
| 64 | Ga0466699_087738 | 3300042597 | Bacteria | 1895 |
| 65 | Ga0466699_121238 | 3300042597 | Bacteria | 1519 |
| 66 | Ga0466716_210197 | 3300042605 | Bacteria | 2163 |
| 67 | Ga0466716_463959 | 3300042605 | Bacteria | 2157 |
| 68 | Ga0466719_081969 | 3300042606 | Bacteria | 1930 |
| 69 | Ga0466722_038108 | 3300042609 | Bacteria | 12237 |
| 70 | Ga0466722_110392 | 3300042609 | Bacteria | 11274 |
| 71 | Ga0123353_10249929 | 3300010167 | Bacteria | 2747 |
| 72 | Ga0123353_10316220 | 3300010167 | Bacteria | 2372 |
| 73 | Ga0123353_10791893 | 3300010167 | Bacteria | 1311 |
| 74 | Ga0466703_043035 | 3300042636 | Bacteria | 15586 |
| 75 | Ga0466708_009161 | 3300042652 | Bacteria | 7299 |
| 76 | Ga0466727_236264 | 3300042655 | Bacteria | 3182 |
| 77 | JGI24698J34947_10013742 | 3300002449 | Bacteria | 4410 |
| 78 | JGI24698J34947_10066320 | 3300002449 | Bacteria | 1756 |
| 79 | JGI24695J34938_10024268 | 3300002450 | Archaea | 2913 |
| 80 | JGI24695J34938_10230836 | 3300002450 | Bacteria | 779 |
| 81 | Ga0072941_1132960 | 3300005201 | Bacteria | 1025 |
| 82 | Ga0466697_089592 | 3300042611 | Bacteria | 1405 |
| 83 | Ga0466705_224852 | 3300042612 | Unclassified | 1073 |
| 84 | Ga0466712_075784 | 3300042614 | Bacteria | 3709 |
| 85 | Ga0466712_124430 | 3300042614 | Bacteria | 5357 |
| 86 | Ga0466711_205238 | 3300042615 | Bacteria | 3026 |
| 87 | Ga0466711_270027 | 3300042615 | Bacteria | 1033 |
| 88 | Ga0466711_271906 | 3300042615 | Bacteria | 8354 |
| 89 | Ga0466715_158124 | 3300042616 | Bacteria | 35948 |
| 90 | Ga0466718_031215 | 3300042617 | Bacteria | 1926 |
| 91 | Ga0466718_054710 | 3300042617 | Bacteria | 1317 |
| 92 | Ga0466726_357789 | 3300042619 | Bacteria | 2090 |
| 93 | Ga0466728_231640 | 3300042620 | Bacteria | 9106 |
| 94 | Ga0456237_0005546 | 3300041968 | Unclassified | 1996 |
| 95 | Ga0456237_0016174 | 3300041968 | Bacteria | 1054 |
| 96 | Ga0466692_176392 | 3300042591 | Bacteria | 1304 |
| 97 | Ga0466692_187753 | 3300042591 | Bacteria | 3996 |
| 98 | Ga0466691_078021 | 3300042593 | Unclassified | 1496 |
| 99 | Ga0466694_196159 | 3300042594 | Bacteria | 7000 |
| 100 | Ga0466699_156888 | 3300042597 | Bacteria | 2147 |
| 101 | Ga0466699_324049 | 3300042597 | Bacteria | 1265 |
| 102 | Ga0466716_273900 | 3300042605 | Bacteria | 4788 |
| 103 | Ga0466719_420420 | 3300042606 | Bacteria | 2107 |
| 104 | Ga0466719_507842 | 3300042606 | Bacteria | 1786 |
| 105 | Ga0466719_527316 | 3300042606 | Bacteria | 3010 |
| 106 | Ga0123356_10002353 | 3300010049 | Bacteria | 20297 |
| 107 | Ga0123356_10082960 | 3300010049 | Bacteria | 3036 |
| 108 | Ga0123353_10453872 | 3300010167 | Bacteria | 1886 |
| 109 | Ga0466735_122545 | 3300042624 | Bacteria | 1543 |
| 110 | Ga0466704_240758 | 3300042643 | Bacteria | 4142 |
| 111 | Ga0466709_174192 | 3300042648 | Bacteria | 8368 |
| 112 | Ga0466709_411590 | 3300042648 | Unclassified | 2137 |
| 113 | Ga0466708_117410 | 3300042652 | Bacteria | 9303 |
| 114 | JGI24698J34947_10012063 | 3300002449 | Bacteria | 4742 |
| 115 | JGI24698J34947_10019066 | 3300002449 | Bacteria | 3704 |
| 116 | JGI24698J34947_10043164 | 3300002449 | Bacteria | 2313 |
| 117 | JGI24698J34947_10091232 | 3300002449 | Bacteria | 1398 |
| 118 | JGI24695J34938_10004706 | 3300002450 | Bacteria | 8834 |
| 119 | JGI24702J35022_10005397 | 3300002462 | Bacteria | 7482 |
| 120 | Ga0072940_1008643 | 3300005200 | Bacteria | 3230 |
| 121 | Ga0072940_1026969 | 3300005200 | Bacteria | 2232 |
| 122 | Ga0072941_1001257 | 3300005201 | Bacteria | 17884 |
| 123 | Ga0466712_033202 | 3300042614 | Bacteria | 4001 |
| 124 | Ga0466711_305760 | 3300042615 | Bacteria | 1298 |
| 125 | Ga0466711_465584 | 3300042615 | Bacteria | 28091 |
| 126 | Ga0466715_187238 | 3300042616 | Bacteria | 4715 |
| 127 | Ga0466726_003926 | 3300042619 | Bacteria | 1742 |
| 128 | Ga0466726_125087 | 3300042619 | Bacteria | 1288 |
| 129 | Ga0466726_278369 | 3300042619 | Bacteria | 1233 |
| 130 | Ga0466728_073385 | 3300042620 | Bacteria | 5324 |
| 131 | Ga0466728_258920 | 3300042620 | Bacteria | 1872 |
| 132 | Ga0466729_033323 | 3300042621 | Bacteria | 1393 |
| 133 | Ga0466713_138466 | 3300042602 | Bacteria | 4027 |
| 134 | Ga0466719_254726 | 3300042606 | Unclassified | 4387 |
| 135 | Ga0466703_209156 | 3300042636 | Bacteria | 8870 |
| 136 | Ga0466703_243611 | 3300042636 | Bacteria | 4055 |
| 137 | Ga0466704_368233 | 3300042643 | Bacteria | 5741 |
| 138 | Ga0466704_559417 | 3300042643 | Bacteria | 7617 |
| 139 | Ga0466708_098346 | 3300042652 | Bacteria | 1333 |
| 140 | Ga0466708_260224 | 3300042652 | Bacteria | 7862 |
| 141 | Ga0466708_348153 | 3300042652 | Bacteria | 5967 |
| 142 | Ga0466727_011324 | 3300042655 | Bacteria | 10866 |
| 143 | JGI24698J34947_10028596 | 3300002449 | Bacteria | 2951 |
| 144 | JGI24698J34947_10060521 | 3300002449 | Bacteria | 1868 |
| 145 | JGI24698J34947_10081565 | 3300002449 | Bacteria | 1515 |
| 146 | JGI24695J34938_10010702 | 3300002450 | Bacteria | 4998 |
| 147 | JGI24695J34938_10073280 | 3300002450 | Unclassified | 1426 |
| 148 | Ga0072941_1104213 | 3300005201 | Bacteria | 1966 |
| 149 | Ga0466705_217443 | 3300042612 | Bacteria | 11009 |
| 150 | Ga0466705_490346 | 3300042612 | Bacteria | 12011 |
| 151 | Ga0466711_137697 | 3300042615 | Bacteria | 22907 |
| 152 | Ga0466715_232354 | 3300042616 | Bacteria | 4328 |
| 153 | Ga0466726_209571 | 3300042619 | Bacteria | 1505 |
| 154 | Ga0466690_046455 | 3300042590 | Bacteria | 1739 |
| 155 | Ga0466691_074861 | 3300042593 | Bacteria | 4071 |
| 156 | Ga0466691_087022 | 3300042593 | Bacteria | 8310 |
| 157 | Ga0466696_028567 | 3300042596 | Bacteria | 18694 |
| 158 | Ga0466707_233056 | 3300042601 | Bacteria | 2084 |
| 159 | Ga0466719_019154 | 3300042606 | Bacteria | 13390 |
| 160 | Ga0466720_231421 | 3300042607 | Bacteria | 4327 |
| 161 | Ga0123353_11295573 | 3300010167 | Bacteria | 946 |
| 162 | Ga0466731_192206 | 3300042622 | Bacteria | 2278 |
| 163 | Ga0466704_203185 | 3300042643 | Bacteria | 3391 |
| 164 | Ga0466708_198765 | 3300042652 | Bacteria | 11728 |
| 165 | AustNasuHG_c1007695 | 3300000089 | Bacteria | 3823 |
| 166 | JGI24698J34947_10030472 | 3300002449 | Unclassified | 2844 |
| 167 | JGI24698J34947_10034223 | 3300002449 | Bacteria | 2660 |
| 168 | JGI24698J34947_10068496 | 3300002449 | Bacteria | 1716 |
| 169 | JGI24698J34947_10118334 | 3300002449 | Bacteria | 1155 |
| 170 | JGI24695J34938_10054374 | 3300002450 | Bacteria | 1736 |
| 171 | Ga0072941_1017045 | 3300005201 | Bacteria | 6509 |
| 172 | Ga0466705_252325 | 3300042612 | Bacteria | 6481 |
| 173 | Ga0466705_506241 | 3300042612 | Bacteria | 9637 |
| 174 | Ga0466712_304506 | 3300042614 | Bacteria | 1397 |
| 175 | Ga0466715_047867 | 3300042616 | Bacteria | 27928 |
| 176 | Ga0466715_262579 | 3300042616 | Bacteria | 8685 |
| 177 | Ga0466718_083997 | 3300042617 | Bacteria | 1450 |
| 178 | Ga0466723_018037 | 3300042618 | Bacteria | 1252 |
| 179 | Ga0466723_324562 | 3300042618 | Bacteria | 4440 |
| 180 | Ga0466726_492356 | 3300042619 | Bacteria | 1109 |
| 181 | Ga0415639_192449 | 3300038395 | Unclassified | 1404 |
| 182 | Ga0456237_0000769 | 3300041968 | Bacteria | 4966 |
| 183 | Ga0466690_016443 | 3300042590 | Bacteria | 2242 |
| 184 | Ga0466692_013932 | 3300042591 | Bacteria | 1754 |
| 185 | Ga0466692_118518 | 3300042591 | Bacteria | 7115 |
| 186 | Ga0466692_133608 | 3300042591 | Unclassified | 3178 |
| 187 | Ga0466692_163202 | 3300042591 | Bacteria | 1640 |
| 188 | Ga0466694_050440 | 3300042594 | Bacteria | 148325 |
| 189 | Ga0466699_353177 | 3300042597 | Bacteria | 28112 |
| 190 | Ga0466716_432226 | 3300042605 | Bacteria | 1256 |
| 191 | Ga0466722_021778 | 3300042609 | Bacteria | 6608 |
| 192 | Ga0466722_226606 | 3300042609 | Bacteria | 1172 |
| 193 | Ga0123353_10194274 | 3300010167 | Bacteria | 3200 |
| 194 | Ga0123353_11315561 | 3300010167 | Bacteria | 937 |
| 195 | Ga0466702_360965 | 3300042635 | Bacteria | 1077 |
| 196 | Ga0466709_288422 | 3300042648 | Bacteria | 4375 |
| 197 | Ga0466708_006182 | 3300042652 | Bacteria | 3801 |
| 198 | Ga0466708_073031 | 3300042652 | Bacteria | 1458 |
| 199 | Ga0466708_157600 | 3300042652 | Bacteria | 13036 |
| 200 | Ga0466708_327203 | 3300042652 | Bacteria | 31501 |
| 201 | JGI24698J34947_10053486 | 3300002449 | Bacteria | 2020 |
| 202 | JGI24695J34938_10000064 | 3300002450 | Bacteria | 87537 |
| 203 | JGI24695J34938_10006885 | 3300002450 | Bacteria | 6748 |
| 204 | JGI24695J34938_10066749 | 3300002450 | Bacteria | 1515 |
| 205 | Ga0072941_1000864 | 3300005201 | Bacteria | 37095 |
| 206 | Ga0072941_1003884 | 3300005201 | Bacteria | 10093 |
| 207 | Ga0072941_1080454 | 3300005201 | Bacteria | 1892 |
| 208 | Ga0466712_017450 | 3300042614 | Bacteria | 1386 |
| 209 | Ga0466712_235442 | 3300042614 | Bacteria | 1550 |
| 210 | Ga0466711_088026 | 3300042615 | Bacteria | 19290 |
| 211 | Ga0466715_113438 | 3300042616 | Bacteria | 1737 |
| 212 | Ga0466718_126144 | 3300042617 | Bacteria | 1714 |
| 213 | Ga0466723_031411 | 3300042618 | Unclassified | 1962 |
| 214 | Ga0466723_055672 | 3300042618 | Bacteria | 6756 |
| 215 | Ga0466723_243195 | 3300042618 | Bacteria | 87629 |
| 216 | Ga0466690_035611 | 3300042590 | Bacteria | 2215 |
| 217 | Ga0466692_022876 | 3300042591 | Bacteria | 1123 |
| 218 | Ga0466692_074298 | 3300042591 | Bacteria | 1775 |
| 219 | Ga0466692_111643 | 3300042591 | Unclassified | 1926 |
| 220 | Ga0466691_081531 | 3300042593 | Bacteria | 6906 |
| 221 | Ga0466691_121264 | 3300042593 | Bacteria | 1155 |
| 222 | Ga0466700_081246 | 3300042600 | Bacteria | 1181 |
| 223 | Ga0466716_437170 | 3300042605 | Bacteria | 5168 |
| 224 | Ga0466721_036380 | 3300042608 | Bacteria | 5607 |
| 225 | Ga0466722_139766 | 3300042609 | Bacteria | 18958 |
| 226 | Ga0466698_197554 | 3300042610 | Bacteria | 1241 |
| 227 | Ga0466735_050535 | 3300042624 | Bacteria | 2005 |
| 228 | Ga0466703_163117 | 3300042636 | Bacteria | 3275 |
| 229 | Ga0466704_072823 | 3300042643 | Unclassified | 7845 |
| 230 | Ga0466704_295581 | 3300042643 | Bacteria | 2619 |
| 231 | Ga0466709_385272 | 3300042648 | Bacteria | 5308 |
| 232 | Ga0466708_008064 | 3300042652 | Bacteria | 3664 |
| 233 | Ga0466708_081635 | 3300042652 | Bacteria | 63753 |
| 234 | Ga0466727_118276 | 3300042655 | Bacteria | 1161 |
| 235 | AustNasuHG_c1024870 | 3300000089 | Bacteria | 1890 |
| 236 | JGI24698J34947_10089116 | 3300002449 | Bacteria | 1421 |
| 237 | JGI24698J34947_10090755 | 3300002449 | Bacteria | 1403 |
| 238 | JGI24698J34947_10093251 | 3300002449 | Bacteria | 1375 |
| 239 | Ga0072941_1178403 | 3300005201 | Bacteria | 1744 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.