Protein Family IF01310

Metagenome Isolate
190 Members
56 Samples
172 Scaffolds
816.63 Avg Length

🧬 Representative Sequence

ID
3300005201|Ga0072941_1025610|Ga0072941_10256109
Length
920 aa
Sequence
MNWVLHFIFNVVYYKQRVKIMEKLFRRPRLIVGIIVAVTVFFGAWISQVELDNNNMRFLPEKNSARLTARYIDETFGGQVIILVGLERPYRTVFERDFLDRIKEYSQAVEAIEYIKNVNSIMSTQYITGDSDSIIVTDLVPDDFTGSEEDISELRRRIASWDLFRGALVSDDLSATQILITLDIMSEDCTKPEVIRSLDKIRDLSHEKFDDLAEVYITGQPVISAIINESLIADNLVLIPMVVFVXXAVLFFSFRRFRFVTLPLLTVAIAVIWAAGAAALLGIKFSIFTTLMPVILLAVGSAYGIHVVTHYARDAKPTHTPDEHRAVVFELMRKIIKPVALAALTTLAGFISFCFTPIVPIREFGYCASMGVVAAFTVAVTFIPSMFLIWGPLKPKVWTPLALWKKQSADIANALNTNIENIENNIDEAGRSQTNGEDRLSNAIARIFLSIARRKNLVLAITAVVAGISIYGLSRVIVDNVLVEYFQNETDISRSDRFIREYFGGSKELNLVIEADTPEELLHPAVLKSVDNLAVFLERIPDVGKVVGFTDIIKRINQVFNVDESPDGLQPSSNNASRFDSDDSGGFGFSDFGFGDDTFDDTPKNENHHDLTQYSAADLLRFLDTAAGKSSGLNGNDLVRELKRLTNYEGMAYYEIPSEPRRYGKDTPEELQRLISNYLVLLAGDDNSGYSNDPLEPTSIRMMIQLRATGNKDTQAVIKEIHAYIASNFPKNVRVIIGGGAMAEAAVTDLVVNSSLISIGISILIVFLIVSISNKSAVAGFIGAAPLALAILCNFAVMGFTGIKLNIATALMGSLAVGIGIDYTIHFIEFFKREYKAGQAIQTDDFLRRTFVGCGKAIIINALSVGAGFGVLAFSRFRIIAELGVVIALCMLITATISLTVIPALLAVIKPKFIYRQGV*

📊 Sample Types

Isolate 9.5%
Metagenome 90.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 35.2%
Termitidae 33.3%
Kalotermitidae 24.1%
Termopsidae 3.7%
Hodotermitidae 1.9%
Rhinotermitidae 1.9%

🌳 Taxonomy

Archaea 0
Bacteria 178
Eukaryota 0
Viruses 2
Unclassified 10

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2228664004 P3 Gut Segment Termite Single Cell Genome_Treponema sp. T3b, from Florida USA Metagenome Termitidae
2 2781125648 Treponema sp. Co191P3bin70 Isolate Unclassified
3 2781125650 Treponema sp. Co191P3bin64 Isolate Unclassified
4 2781125651 Treponema sp. Co191P3bin8 Isolate Unclassified
5 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
6 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
7 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
8 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
9 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
10 2781125696 Treponema sp. Th196P4bin22 Isolate Unclassified
11 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
12 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
13 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
14 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
15 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
16 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
17 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
18 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
19 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
20 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
21 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
22 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
23 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
24 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
25 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
26 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
27 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
28 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
29 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
30 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
31 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
32 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
33 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
34 2781125694 Treponema sp. Th196P3bin120 Isolate Unclassified
35 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
36 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
37 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
38 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
39 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
40 2781125689 Treponema sp. Mp193P4bin9 Isolate Unclassified
41 2781125631 Treponema sp. Nt197P3bin89 Isolate Unclassified
42 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
43 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
44 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
45 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
46 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
47 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
48 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
49 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
50 2228664001 P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4a from Florida USA Metagenome Termitidae
51 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
52 2781125641 Treponema sp. Co191P1bin27 Isolate Unclassified
53 2781125642 Treponema sp. Co191P1bin35 Isolate Unclassified
54 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
55 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
56 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466712_032344 3300042614 Bacteria 20671
2 Ga0466712_102588 3300042614 Bacteria 46662
3 Ga0466718_047347 3300042617 Bacteria 12962
4 Ga0466718_086242 3300042617 Bacteria 67871
5 Ga0466723_013457 3300042618 Bacteria 25413
6 Ga0466726_013205 3300042619 Bacteria 40271
7 Ga0466728_048615 3300042620 Bacteria 9655
8 Ga0466728_305498 3300042620 Bacteria 6294
9 Ga0466703_172848 3300042636 Unclassified 12739
10 Ga0466720_080512 3300042607 Bacteria 26691
11 Ga0466698_438811 3300042610 Unclassified 7680
12 JGI24698J34947_10003185 3300002449 Bacteria 8890
13 JGI24698J34947_10005448 3300002449 Bacteria 6985
14 JGI24698J34947_10015771 3300002449 Bacteria 4109
15 JGI24695J34938_10000016 3300002450 Bacteria 116336
16 JGI24695J34938_10000313 3300002450 Bacteria 47889
17 JGI24695J34938_10003074 3300002450 Unclassified 11953
18 JGI24702J35022_10003360 3300002462 Bacteria 9671
19 Ga0072941_1008777 3300005201 Bacteria 14458
20 Ga0466690_013799 3300042590 Bacteria 19301
21 Ga0466705_254521 3300042612 Bacteria 20492
22 Ga0466732_193389 3300042656 Bacteria 11310
23 Ga0466712_045431 3300042614 Unclassified 11277
24 Ga0466715_111516 3300042616 Bacteria 8179
25 Ga0466718_094804 3300042617 Bacteria 21367
26 Ga0466704_429929 3300042643 Bacteria 10041
27 Ga0466727_109649 3300042655 Bacteria 5375
28 Ga0466716_218606 3300042605 Bacteria 13881
29 Ga0466719_238215 3300042606 Bacteria 5994
30 Ga0466720_022178 3300042607 Bacteria 17065
31 Ga0466720_040130 3300042607 Unclassified 9516
32 2230930085 2228664001 Bacteria 3347
33 JGI24698J34947_10005588 3300002449 Bacteria 6899
34 JGI24695J34938_10000166 3300002450 Bacteria 61678
35 JGI24695J34938_10000314 3300002450 Bacteria 47830
36 JGI24695J34938_10001171 3300002450 Bacteria 23318
37 JGI24697J35500_11273160 3300002507 Bacteria 5418
38 Ga0466693_442298 3300042592 Bacteria 86235
39 Ga0466696_040567 3300042596 Bacteria 7090
40 Ga0466699_010743 3300042597 Bacteria 15176
41 Ga0466699_218806 3300042597 Bacteria 17479
42 Ga0466712_060986 3300042614 Bacteria 8916
43 Ga0466712_118323 3300042614 Bacteria 21090
44 Ga0466712_245660 3300042614 Bacteria 17153
45 Ga0466715_553008 3300042616 Bacteria 12913
46 Ga0466718_008075 3300042617 Bacteria 5321
47 Ga0466718_046136 3300042617 Bacteria 7441
48 Ga0466718_108253 3300042617 Bacteria 7668
49 Ga0466723_067715 3300042618 Bacteria 16970
50 Ga0466709_184151 3300042648 Bacteria 6456
51 Ga0466709_313251 3300042648 Bacteria 9058
52 Ga0466719_181234 3300042606 Bacteria 6587
53 Ga0466720_127618 3300042607 Bacteria 11645
54 Ga0466720_129248 3300042607 Bacteria 18987
55 Ga0466722_226500 3300042609 Bacteria 7213
56 2230969688 2228664004 Bacteria 4865
57 AustNasuHG_c1003645 3300000089 Bacteria 5557
58 JGI24698J34947_10001071 3300002449 Bacteria 14085
59 JGI24698J34947_10004521 3300002449 Bacteria 7572
60 JGI24695J34938_10000386 3300002450 Bacteria 43698
61 JGI24695J34938_10000976 3300002450 Bacteria 26065
62 JGI24699J35502_11124776 3300002509 Bacteria 3708
63 Ga0466693_015228 3300042592 Unclassified 9327
64 Ga0466696_094897 3300042596 Bacteria 4093
65 Ga0466732_332763 3300042656 Bacteria 7014
66 Ga0466712_059527 3300042614 Bacteria 7032
67 Ga0466718_009436 3300042617 Bacteria 7106
68 Ga0466728_212437 3300042620 Unclassified 5254
69 Ga0466703_012071 3300042636 Bacteria 25626
70 Ga0466703_243553 3300042636 Bacteria 7630
71 Ga0466704_125719 3300042643 Bacteria 17212
72 Ga0466704_164913 3300042643 Bacteria 3502
73 Ga0466704_545659 3300042643 Unclassified 6938
74 Ga0466704_577674 3300042643 Bacteria 29271
75 Ga0466716_334452 3300042605 Viruses 6758
76 Ga0466719_034033 3300042606 Bacteria 17474
77 Ga0466719_115534 3300042606 Bacteria 6782
78 Ga0466720_154299 3300042607 Bacteria 16533
79 Ga0466722_076177 3300042609 Bacteria 29982
80 JGI24698J34947_10000072 3300002449 Bacteria 32302
81 JGI24698J34947_10003742 3300002449 Bacteria 8281
82 JGI24695J34938_10000171 3300002450 Bacteria 60520
83 JGI24695J34938_10001948 3300002450 Bacteria 16571
84 JGI24695J34938_10002216 3300002450 Bacteria 15134
85 JGI24695J34938_10002305 3300002450 Bacteria 14716
86 Ga0072941_1011066 3300005201 Bacteria 6709
87 Ga0074263_118339 3300005485 Bacteria 3114
88 Ga0264413_108935 3300024493 Bacteria 6198
89 Ga0466694_145285 3300042594 Bacteria 15043
90 Ga0466696_027485 3300042596 Bacteria 13075
91 Ga0466696_282957 3300042596 Bacteria 6814
92 Ga0466699_043720 3300042597 Bacteria 24375
93 Ga0466732_274726 3300042656 Bacteria 6383
94 Ga0466732_284490 3300042656 Bacteria 3538
95 Ga0466712_320346 3300042614 Bacteria 17677
96 Ga0466718_025488 3300042617 Bacteria 4394
97 Ga0466723_001998 3300042618 Bacteria 19388
98 Ga0466728_022240 3300042620 Bacteria 5594
99 Ga0466728_207316 3300042620 Bacteria 2816
100 Ga0466709_012864 3300042648 Bacteria 16905
101 Ga0466708_440301 3300042652 Bacteria 2925
102 Ga0466719_117303 3300042606 Bacteria 10595
103 Ga0466720_186762 3300042607 Bacteria 15310
104 JGI24698J34947_10018087 3300002449 Bacteria 3813
105 JGI24698J34947_10018105 3300002449 Bacteria 3812
106 JGI24698J34947_10030386 3300002449 Bacteria 2849
107 JGI24695J34938_10001572 3300002450 Bacteria 19222
108 JGI24695J34938_10003935 3300002450 Bacteria 10030
109 JGI24695J34938_10009870 3300002450 Bacteria 5273
110 Ga0072941_1010125 3300005201 Bacteria 32533
111 Ga0264413_100437 3300024493 Bacteria 67663
112 Ga0466690_249193 3300042590 Bacteria 6120
113 Ga0466691_058612 3300042593 Bacteria 167737
114 Ga0466691_065585 3300042593 Bacteria 9383
115 Ga0466696_082295 3300042596 Bacteria 7265
116 Ga0466699_046280 3300042597 Bacteria 20535
117 Ga0466699_171552 3300042597 Bacteria 6873
118 Ga0466732_011392 3300042656 Bacteria 7150
119 Ga0466712_175017 3300042614 Bacteria 45826
120 Ga0466731_053969 3300042622 Bacteria 8208
121 Ga0466727_096848 3300042655 Bacteria 6868
122 Ga0466706_041119 3300042599 Bacteria 15187
123 Ga0466716_198087 3300042605 Bacteria 9848
124 Ga0466719_110050 3300042606 Bacteria 8583
125 Ga0466719_367324 3300042606 Bacteria 7285
126 Ga0466720_052064 3300042607 Bacteria 25001
127 AustNasuHG_c1002888 3300000089 Viruses 6202
128 JGI24698J34947_10004728 3300002449 Bacteria 7433
129 JGI24698J34947_10007116 3300002449 Bacteria 6146
130 JGI24698J34947_10026525 3300002449 Bacteria 3078
131 JGI24695J34938_10011590 3300002450 Bacteria 4740
132 Ga0466690_003445 3300042590 Bacteria 16066
133 Ga0466691_040939 3300042593 Bacteria 11459
134 Ga0466691_116226 3300042593 Bacteria 3429
135 Ga0466705_197328 3300042612 Bacteria 6945
136 Ga0466732_124642 3300042656 Bacteria 7090
137 Ga0466723_199833 3300042618 Bacteria 12021
138 Ga0466703_051252 3300042636 Bacteria 5761
139 Ga0466704_433482 3300042643 Bacteria 11013
140 Ga0466704_516670 3300042643 Bacteria 15577
141 Ga0466719_200381 3300042606 Bacteria 5256
142 Ga0466720_050046 3300042607 Bacteria 17467
143 Ga0466722_025485 3300042609 Bacteria 59385
144 JGI24698J34947_10006230 3300002449 Unclassified 6553
145 JGI24698J34947_10011035 3300002449 Bacteria 4955
146 JGI24698J34947_10016957 3300002449 Bacteria 3951
147 JGI24695J34938_10000156 3300002450 Bacteria 63017
148 Ga0068305_10011166 3300005083 Bacteria 10752
149 Ga0072941_1015718 3300005201 Bacteria 12704
150 Ga0072941_1025610 3300005201 Bacteria 9383
151 Ga0466691_035489 3300042593 Bacteria 18589
152 Ga0466732_015066 3300042656 Bacteria 5572
153 Ga0466712_054317 3300042614 Unclassified 31713
154 Ga0466712_066087 3300042614 Bacteria 10870
155 Ga0466723_004283 3300042618 Bacteria 7963
156 Ga0466708_015104 3300042652 Bacteria 9993
157 Ga0466716_373317 3300042605 Bacteria 5665
158 Ga0466720_009218 3300042607 Bacteria 21774
159 Ga0466720_133345 3300042607 Bacteria 7862
160 AustNasuHG_c1000370 3300000089 Bacteria 15597
161 AustNasuHG_c1000640 3300000089 Bacteria 12356
162 JGI24698J34947_10000129 3300002449 Bacteria 27611
163 JGI24698J34947_10000726 3300002449 Bacteria 16241
164 JGI24698J34947_10001615 3300002449 Bacteria 11981
165 JGI24695J34938_10000062 3300002450 Bacteria 88353
166 JGI24695J34938_10001241 3300002450 Bacteria 22427
167 JGI24695J34938_10001510 3300002450 Bacteria 19620
168 JGI24695J34938_10005491 3300002450 Bacteria 7884
169 Ga0072941_1001217 3300005201 Bacteria 31007
170 Ga0072941_1092317 3300005201 Bacteria 4220
171 Ga0466690_298785 3300042590 Bacteria 3919
172 Ga0466699_103288 3300042597 Bacteria 9431

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF03176 MMPL MMPL family 699 909 0.91
PF00873 ACR_tran AcrB/AcrD/AcrF family 700 909 0.84
PF12349 Sterol-sensing Sterol-sensing domain of SREBP cleavage-activation 263 385 0.83

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF03176 GO:0016020 membrane CC

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.