Protein Family IF01300
Metagenome
Metatranscriptome
Isolate
186
Members
40
Samples
173
Scaffolds
308.66
Avg Length
Representative Sequence
- ID
- 3300005201|Ga0072941_1020135|Ga0072941_10201355
- Length
- 339 aa
- Sequence
- MNNKMNIKAIKNFFPVFLVKYLPKYFMKKNEKLGFTLEGKNARAGYLFILPFLIGFILFMLMPIFESLRMAFSKVTIDVVNSGFKMEFTGFENVLRALTIDADFNRMLVEELVRMVLIVPAVIIFSLFIAIILNQEFKARGFVRAVFFLPVILSSGVLVGLETNNALLQSVAETIKQSNSLKTSITGVLENILAAEGAASNFMKYIFQVVNQIYNIAMASGIQIIIFLSALQTIPVSMFEAAKIEGATSWECFWKITFPMVSSLILVNAVYSVVDYFLRIGGRVPGANNEIMERIFITLVNNLDFGYSSAMAWFYFLIVAIVIGVVFAIFSKRVYYYE*
Sample Types
Isolate
7.0%
Metagenome
92.5%
MAG
0.0%
Metatranscriptome
0.5%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
61.1%
Unclassified
33.3%
Rhinotermitidae
2.8%
Kalotermitidae
2.8%
Taxonomy
Archaea
1
Bacteria
168
Eukaryota
0
Viruses
1
Unclassified
16
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 2 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 3 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 4 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 5 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 6 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 7 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 8 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 9 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 10 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 11 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 12 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 13 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 14 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 15 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 16 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 17 | 2781125638 | Treponema sp. Co191P1bin8 | Isolate | Unclassified |
| 18 | 2781125649 | Treponema sp. Co191P3bin15 | Isolate | Unclassified |
| 19 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 20 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 21 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 22 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 23 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 24 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 25 | 2781125640 | Treponema sp. Co191P1bin37 | Isolate | Unclassified |
| 26 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 27 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 28 | 2740892545 | Fibrobacteria bacterium GUT31 IN01_31 | Isolate | Unclassified |
| 29 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 30 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 31 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 32 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 33 | 2781125642 | Treponema sp. Co191P1bin35 | Isolate | Unclassified |
| 34 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 35 | 2781125651 | Treponema sp. Co191P3bin8 | Isolate | Unclassified |
| 36 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 37 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 38 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 39 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 40 | 3300021235 | Termite gut microbial communities from nest from French Guiana - FG16_2_6 mRNA SA | Metatranscriptome |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0264413_114721 | 3300024493 | Bacteria | 7218 |
| 2 | Ga0264413_114722 | 3300024493 | Unclassified | 2779 |
| 3 | Ga0415639_025562 | 3300038395 | Bacteria | 26729 |
| 4 | Ga0466699_059315 | 3300042597 | Bacteria | 19579 |
| 5 | Ga0466712_011600 | 3300042614 | Bacteria | 7877 |
| 6 | Ga0466712_050770 | 3300042614 | Bacteria | 36007 |
| 7 | Ga0466712_201567 | 3300042614 | Bacteria | 7869 |
| 8 | Ga0466712_252323 | 3300042614 | Bacteria | 18721 |
| 9 | Ga0466718_010203 | 3300042617 | Bacteria | 10390 |
| 10 | Ga0466720_005396 | 3300042607 | Bacteria | 5991 |
| 11 | Ga0466698_244652 | 3300042610 | Bacteria | 1990 |
| 12 | Ga0123356_10000415 | 3300010049 | Bacteria | 48650 |
| 13 | Ga0123356_10000895 | 3300010049 | Bacteria | 32977 |
| 14 | Ga0123356_10003113 | 3300010049 | Bacteria | 17506 |
| 15 | Ga0123356_10031817 | 3300010049 | Bacteria | 4938 |
| 16 | AustNasuHG_c1000453 | 3300000089 | Bacteria | 14360 |
| 17 | AustNasuHG_c1007465 | 3300000089 | Bacteria | 3893 |
| 18 | AustNasuHG_c1018547 | 3300000089 | Unclassified | 2295 |
| 19 | JGI24695J34938_10003704 | 3300002450 | Bacteria | 10447 |
| 20 | Ga0074263_105692 | 3300005485 | Unclassified | 2843 |
| 21 | Ga0415639_002725 | 3300038395 | Bacteria | 8534 |
| 22 | Ga0466694_029156 | 3300042594 | Bacteria | 68693 |
| 23 | Ga0466694_110585 | 3300042594 | Bacteria | 11046 |
| 24 | Ga0466694_221922 | 3300042594 | Bacteria | 39680 |
| 25 | Ga0466699_027701 | 3300042597 | Bacteria | 1173 |
| 26 | Ga0466712_036582 | 3300042614 | Bacteria | 15193 |
| 27 | Ga0466712_053885 | 3300042614 | Bacteria | 16963 |
| 28 | Ga0466728_239290 | 3300042620 | Bacteria | 10809 |
| 29 | Ga0466702_353845 | 3300042635 | Bacteria | 2471 |
| 30 | Ga0123355_10009862 | 3300009826 | Bacteria | 14573 |
| 31 | Ga0123356_10001803 | 3300010049 | Bacteria | 23328 |
| 32 | AustNasuHG_c1039286 | 3300000089 | Bacteria | 1178 |
| 33 | JGI24698J34947_10000223 | 3300002449 | Bacteria | 23530 |
| 34 | JGI24698J34947_10000387 | 3300002449 | Bacteria | 19899 |
| 35 | JGI24698J34947_10000482 | 3300002449 | Bacteria | 18705 |
| 36 | JGI24698J34947_10000563 | 3300002449 | Bacteria | 17638 |
| 37 | JGI24698J34947_10001124 | 3300002449 | Bacteria | 13831 |
| 38 | JGI24698J34947_10004365 | 3300002449 | Bacteria | 7693 |
| 39 | JGI24698J34947_10011132 | 3300002449 | Bacteria | 4937 |
| 40 | JGI24698J34947_10013520 | 3300002449 | Bacteria | 4455 |
| 41 | JGI24698J34947_10083139 | 3300002449 | Unclassified | 1495 |
| 42 | JGI24695J34938_10000501 | 3300002450 | Bacteria | 38048 |
| 43 | JGI24695J34938_10001109 | 3300002450 | Bacteria | 24296 |
| 44 | JGI24695J34938_10045245 | 3300002450 | Bacteria | 1953 |
| 45 | Ga0072941_1034127 | 3300005201 | Bacteria | 9697 |
| 46 | Ga0264413_103677 | 3300024493 | Bacteria | 6409 |
| 47 | Ga0466694_042205 | 3300042594 | Bacteria | 30345 |
| 48 | Ga0466694_150151 | 3300042594 | Bacteria | 3138 |
| 49 | Ga0466699_119092 | 3300042597 | Bacteria | 6981 |
| 50 | Ga0466699_203238 | 3300042597 | Bacteria | 4467 |
| 51 | Ga0466712_023019 | 3300042614 | Bacteria | 12855 |
| 52 | Ga0466712_023799 | 3300042614 | Bacteria | 49566 |
| 53 | Ga0466712_062663 | 3300042614 | Bacteria | 15064 |
| 54 | Ga0466712_143259 | 3300042614 | Bacteria | 21094 |
| 55 | Ga0466712_169754 | 3300042614 | Bacteria | 3712 |
| 56 | Ga0466718_011694 | 3300042617 | Bacteria | 3751 |
| 57 | Ga0466718_074668 | 3300042617 | Bacteria | 12150 |
| 58 | Ga0466718_104789 | 3300042617 | Bacteria | 6046 |
| 59 | Ga0466720_007150 | 3300042607 | Bacteria | 10712 |
| 60 | Ga0466720_094824 | 3300042607 | Unclassified | 3680 |
| 61 | Ga0123356_10004329 | 3300010049 | Bacteria | 14684 |
| 62 | Ga0123356_10094958 | 3300010049 | Bacteria | 2849 |
| 63 | Ga0123353_10005132 | 3300010167 | Bacteria | 17103 |
| 64 | JGI24698J34947_10000864 | 3300002449 | Bacteria | 15280 |
| 65 | JGI24698J34947_10007636 | 3300002449 | Bacteria | 5944 |
| 66 | JGI24698J34947_10044800 | 3300002449 | Bacteria | 2262 |
| 67 | JGI24695J34938_10001305 | 3300002450 | Bacteria | 21792 |
| 68 | JGI24695J34938_10001655 | 3300002450 | Bacteria | 18530 |
| 69 | Ga0264413_100832 | 3300024493 | Archaea | 5165 |
| 70 | Ga0264413_105462 | 3300024493 | Unclassified | 5775 |
| 71 | Ga0466694_108077 | 3300042594 | Bacteria | 9739 |
| 72 | Ga0466694_212689 | 3300042594 | Bacteria | 44215 |
| 73 | Ga0466699_026631 | 3300042597 | Bacteria | 5249 |
| 74 | Ga0466699_053066 | 3300042597 | Bacteria | 14648 |
| 75 | Ga0466712_242352 | 3300042614 | Bacteria | 15742 |
| 76 | Ga0466712_298055 | 3300042614 | Bacteria | 5938 |
| 77 | Ga0466712_319022 | 3300042614 | Bacteria | 2252 |
| 78 | Ga0466718_163984 | 3300042617 | Bacteria | 3732 |
| 79 | Ga0466731_200694 | 3300042622 | Bacteria | 5267 |
| 80 | Ga0466702_022724 | 3300042635 | Bacteria | 1069 |
| 81 | Ga0123356_10005491 | 3300010049 | Bacteria | 12902 |
| 82 | Ga0123356_10005594 | 3300010049 | Bacteria | 12780 |
| 83 | Ga0123353_10054644 | 3300010167 | Bacteria | 6387 |
| 84 | AustNasuHG_c1001426 | 3300000089 | Bacteria | 8542 |
| 85 | JGI24698J34947_10000209 | 3300002449 | Bacteria | 23902 |
| 86 | JGI24698J34947_10012861 | 3300002449 | Bacteria | 4574 |
| 87 | JGI24695J34938_10000871 | 3300002450 | Bacteria | 27909 |
| 88 | JGI24695J34938_10002759 | 3300002450 | Bacteria | 12902 |
| 89 | JGI24695J34938_10025454 | 3300002450 | Bacteria | 2828 |
| 90 | JGI24695J34938_10029116 | 3300002450 | Bacteria | 2587 |
| 91 | JGI24695J34938_10039075 | 3300002450 | Bacteria | 2146 |
| 92 | JGI24695J34938_10127059 | 3300002450 | Bacteria | 1039 |
| 93 | Ga0072941_1020134 | 3300005201 | Unclassified | 4135 |
| 94 | Ga0223674_1021454 | 3300021235 | Unclassified | 1441 |
| 95 | Ga0466699_000679 | 3300042597 | Bacteria | 6906 |
| 96 | Ga0466699_037050 | 3300042597 | Bacteria | 18792 |
| 97 | Ga0466699_172393 | 3300042597 | Bacteria | 6448 |
| 98 | Ga0466699_344300 | 3300042597 | Bacteria | 2172 |
| 99 | Ga0466712_004271 | 3300042614 | Bacteria | 18054 |
| 100 | Ga0466712_005623 | 3300042614 | Unclassified | 4111 |
| 101 | Ga0466712_023384 | 3300042614 | Bacteria | 7777 |
| 102 | Ga0466712_213292 | 3300042614 | Bacteria | 3896 |
| 103 | Ga0466712_266224 | 3300042614 | Bacteria | 24891 |
| 104 | Ga0466718_133035 | 3300042617 | Bacteria | 7313 |
| 105 | Ga0466702_100956 | 3300042635 | Bacteria | 39373 |
| 106 | Ga0466720_029897 | 3300042607 | Bacteria | 16337 |
| 107 | Ga0466720_189522 | 3300042607 | Bacteria | 75127 |
| 108 | Ga0123356_10000488 | 3300010049 | Bacteria | 44166 |
| 109 | Ga0123356_10155384 | 3300010049 | Bacteria | 2277 |
| 110 | Ga0123356_10218986 | 3300010049 | Bacteria | 1958 |
| 111 | AustNasuHG_c1019511 | 3300000089 | Bacteria | 2223 |
| 112 | JGI24695J34938_10000474 | 3300002450 | Bacteria | 38967 |
| 113 | Ga0072941_1011666 | 3300005201 | Unclassified | 19337 |
| 114 | Ga0072941_1020270 | 3300005201 | Unclassified | 4827 |
| 115 | Ga0072941_1078496 | 3300005201 | Bacteria | 10395 |
| 116 | Ga0466732_147048 | 3300042656 | Bacteria | 6914 |
| 117 | Ga0264413_116428 | 3300024493 | Bacteria | 6443 |
| 118 | Ga0466692_178944 | 3300042591 | Bacteria | 3285 |
| 119 | Ga0466699_030982 | 3300042597 | Bacteria | 38155 |
| 120 | Ga0466712_029943 | 3300042614 | Bacteria | 25964 |
| 121 | Ga0466712_069904 | 3300042614 | Bacteria | 14907 |
| 122 | Ga0466702_074384 | 3300042635 | Bacteria | 2182 |
| 123 | Ga0466721_186246 | 3300042608 | Bacteria | 3230 |
| 124 | Ga0123356_10004757 | 3300010049 | Bacteria | 13972 |
| 125 | Ga0123353_10170660 | 3300010167 | Bacteria | 3453 |
| 126 | JGI24695J34938_10000138 | 3300002450 | Bacteria | 66191 |
| 127 | JGI24695J34938_10015975 | 3300002450 | Unclassified | 3833 |
| 128 | Ga0072941_1020135 | 3300005201 | Bacteria | 5387 |
| 129 | Ga0466732_395551 | 3300042656 | Bacteria | 26916 |
| 130 | Ga0466692_016491 | 3300042591 | Bacteria | 3360 |
| 131 | Ga0466699_241561 | 3300042597 | Bacteria | 1958 |
| 132 | Ga0466718_006860 | 3300042617 | Bacteria | 24248 |
| 133 | Ga0466718_063778 | 3300042617 | Viruses | 1920 |
| 134 | Ga0466702_277403 | 3300042635 | Bacteria | 11663 |
| 135 | Ga0466714_140691 | 3300042603 | Bacteria | 2894 |
| 136 | Ga0466720_196710 | 3300042607 | Bacteria | 4964 |
| 137 | Ga0123356_10000426 | 3300010049 | Bacteria | 48138 |
| 138 | Ga0123356_10009798 | 3300010049 | Bacteria | 9442 |
| 139 | Ga0123356_10037332 | 3300010049 | Unclassified | 4534 |
| 140 | Ga0123356_10151773 | 3300010049 | Bacteria | 2301 |
| 141 | Ga0123356_10365019 | 3300010049 | Bacteria | 1572 |
| 142 | AustNasuHG_c1000061 | 3300000089 | Bacteria | 29194 |
| 143 | JGI24698J34947_10000885 | 3300002449 | Bacteria | 15156 |
| 144 | JGI24698J34947_10002391 | 3300002449 | Bacteria | 10105 |
| 145 | JGI24698J34947_10005167 | 3300002449 | Bacteria | 7157 |
| 146 | JGI24698J34947_10041770 | 3300002449 | Unclassified | 2360 |
| 147 | JGI24695J34938_10000707 | 3300002450 | Bacteria | 31446 |
| 148 | JGI24695J34938_10001905 | 3300002450 | Bacteria | 16859 |
| 149 | JGI24695J34938_10003623 | 3300002450 | Bacteria | 10612 |
| 150 | JGI24695J34938_10015889 | 3300002450 | Bacteria | 3848 |
| 151 | JGI24702J35022_10002096 | 3300002462 | Bacteria | 12315 |
| 152 | JGI24705J35276_12122938 | 3300002504 | Bacteria | 1078 |
| 153 | Ga0072941_1008943 | 3300005201 | Bacteria | 19190 |
| 154 | Ga0072941_1088747 | 3300005201 | Bacteria | 4840 |
| 155 | Ga0415639_067545 | 3300038395 | Bacteria | 14121 |
| 156 | Ga0466699_123671 | 3300042597 | Bacteria | 11282 |
| 157 | Ga0466699_141262 | 3300042597 | Bacteria | 1612 |
| 158 | Ga0466712_042934 | 3300042614 | Bacteria | 38848 |
| 159 | Ga0466712_063991 | 3300042614 | Bacteria | 24908 |
| 160 | Ga0466712_118388 | 3300042614 | Bacteria | 4074 |
| 161 | Ga0466712_130270 | 3300042614 | Unclassified | 3386 |
| 162 | Ga0466718_018819 | 3300042617 | Bacteria | 2913 |
| 163 | Ga0466720_073097 | 3300042607 | Bacteria | 4199 |
| 164 | Ga0466720_119639 | 3300042607 | Bacteria | 7913 |
| 165 | FAAS_10005629 | 3300001880 | Unclassified | 1503 |
| 166 | JGI24698J34947_10000265 | 3300002449 | Bacteria | 22370 |
| 167 | JGI24698J34947_10015434 | 3300002449 | Bacteria | 4157 |
| 168 | JGI24698J34947_10035520 | 3300002449 | Bacteria | 2601 |
| 169 | JGI24695J34938_10000912 | 3300002450 | Bacteria | 27225 |
| 170 | JGI24695J34938_10002433 | 3300002450 | Bacteria | 14266 |
| 171 | JGI24695J34938_10013612 | 3300002450 | Bacteria | 4260 |
| 172 | Ga0072940_1005046 | 3300005200 | Bacteria | 9941 |
| 173 | Ga0072941_1001886 | 3300005201 | Bacteria | 139305 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.