Protein Family IF01299
Metagenome
Isolate
211
Members
55
Samples
203
Scaffolds
321.16
Avg Length
Representative Sequence
- ID
- 3300005201|Ga0072941_1019852|Ga0072941_10198527
- Length
- 363 aa
- Sequence
- MRILFAGTPAIAVPSLEAIAAMSGGGDDFVLAGLLTKADSPKGRSGKPEPTECAVAAASSIPQLKPEKLDSAAREQAAALNADLLVSFAYGKIFGPKFLALFPLGGINIHPSLLPKYRGPTPISAAILNREAVTGITIQRLAAEMDSGDILVQETVPLNGRETTANLSETMAKKAAEILPAALRGIAGGTLTAKPQDHNAATYCSLIEKEDGLIDWNQSAAKIDAQIRAFDPWPLSWTTHGELQLFVLKAQALEGEYAAEPPVHLAGRSPAGLAKASPPFLLQRPLSGLSPCGLSQETQLNAVHLAGRVLGKDKDMGILIQTGDGILAVSELQYRTKKALEWKAFLNGARNFLGATLGNVAR*
Sample Types
Isolate
3.8%
Metagenome
96.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
41.5%
Kalotermitidae
26.4%
Unclassified
18.9%
Rhinotermitidae
5.7%
Termopsidae
5.7%
Hodotermitidae
1.9%
Taxonomy
Archaea
0
Bacteria
204
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 2 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 3 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 4 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 5 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 6 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 7 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 8 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 9 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 10 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 11 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 12 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 13 | 2781125695 | Treponema sp. Th196P4bin30 | Isolate | Unclassified |
| 14 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 15 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 16 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 17 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 18 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 19 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 20 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 21 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 22 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 23 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 24 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 25 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 26 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 27 | 2781125638 | Treponema sp. Co191P1bin8 | Isolate | Unclassified |
| 28 | 2781125639 | Treponema sp. Co191P1bin44 | Isolate | Unclassified |
| 29 | 2781125649 | Treponema sp. Co191P3bin15 | Isolate | Unclassified |
| 30 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 31 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 32 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 33 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 34 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 35 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 36 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 37 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 38 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 39 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 40 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 41 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 42 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 43 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 44 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 45 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 46 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 47 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 48 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 49 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 50 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 51 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 52 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 53 | 2781125689 | Treponema sp. Mp193P4bin9 | Isolate | Unclassified |
| 54 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 55 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_184053 | 3300042612 | Bacteria | 5505 |
| 2 | Ga0466705_319125 | 3300042612 | Bacteria | 7939 |
| 3 | Ga0123356_10000067 | 3300010049 | Bacteria | 109410 |
| 4 | Ga0466712_049384 | 3300042614 | Bacteria | 5141 |
| 5 | Ga0466712_081403 | 3300042614 | Bacteria | 5468 |
| 6 | Ga0466718_062769 | 3300042617 | Bacteria | 1631 |
| 7 | Ga0466723_017440 | 3300042618 | Bacteria | 24222 |
| 8 | Ga0466723_160902 | 3300042618 | Bacteria | 23441 |
| 9 | Ga0466728_300370 | 3300042620 | Bacteria | 4884 |
| 10 | Ga0466692_002401 | 3300042591 | Unclassified | 15501 |
| 11 | Ga0466699_005595 | 3300042597 | Bacteria | 2369 |
| 12 | JGI24698J34947_10008212 | 3300002449 | Bacteria | 5727 |
| 13 | JGI24698J34947_10030718 | 3300002449 | Bacteria | 2832 |
| 14 | Ga0072941_1000021 | 3300005201 | Bacteria | 7451 |
| 15 | Ga0072941_1019852 | 3300005201 | Unclassified | 7795 |
| 16 | Ga0072941_1063571 | 3300005201 | Bacteria | 1836 |
| 17 | Ga0466731_089596 | 3300042622 | Bacteria | 24532 |
| 18 | Ga0466704_333824 | 3300042643 | Bacteria | 21099 |
| 19 | Ga0466708_061097 | 3300042652 | Bacteria | 11960 |
| 20 | Ga0466705_197675 | 3300042612 | Bacteria | 7780 |
| 21 | Ga0123356_10034163 | 3300010049 | Bacteria | 4755 |
| 22 | Ga0466712_070916 | 3300042614 | Bacteria | 20641 |
| 23 | Ga0466712_217249 | 3300042614 | Bacteria | 27211 |
| 24 | Ga0466719_297251 | 3300042606 | Bacteria | 8240 |
| 25 | Ga0466720_023379 | 3300042607 | Bacteria | 5297 |
| 26 | Ga0466720_103351 | 3300042607 | Bacteria | 1790 |
| 27 | Ga0466720_108612 | 3300042607 | Bacteria | 122313 |
| 28 | Ga0466720_128924 | 3300042607 | Bacteria | 3528 |
| 29 | Ga0466720_141100 | 3300042607 | Bacteria | 3000 |
| 30 | Ga0466720_206455 | 3300042607 | Bacteria | 6773 |
| 31 | Ga0466722_138823 | 3300042609 | Bacteria | 2651 |
| 32 | Ga0466722_175562 | 3300042609 | Unclassified | 6330 |
| 33 | Ga0264413_109565 | 3300024493 | Bacteria | 11496 |
| 34 | Ga0466690_324624 | 3300042590 | Unclassified | 4188 |
| 35 | Ga0466693_358736 | 3300042592 | Bacteria | 5006 |
| 36 | Ga0466691_003008 | 3300042593 | Bacteria | 4901 |
| 37 | Ga0466696_089145 | 3300042596 | Bacteria | 4233 |
| 38 | Ga0466696_093358 | 3300042596 | Unclassified | 7748 |
| 39 | Ga0466699_147966 | 3300042597 | Bacteria | 13012 |
| 40 | JGI24695J34938_10005041 | 3300002450 | Bacteria | 8402 |
| 41 | Ga0072941_1030573 | 3300005201 | Bacteria | 4787 |
| 42 | Ga0072941_1048488 | 3300005201 | Bacteria | 4532 |
| 43 | Ga0072941_1079422 | 3300005201 | Bacteria | 5372 |
| 44 | Ga0466735_158757 | 3300042624 | Bacteria | 1239 |
| 45 | Ga0466704_567552 | 3300042643 | Bacteria | 13451 |
| 46 | Ga0466708_081175 | 3300042652 | Bacteria | 2829 |
| 47 | Ga0466727_093702 | 3300042655 | Bacteria | 11657 |
| 48 | Ga0466705_369622 | 3300042612 | Bacteria | 26304 |
| 49 | Ga0466733_151161 | 3300042659 | Bacteria | 29907 |
| 50 | Ga0466712_086549 | 3300042614 | Bacteria | 18204 |
| 51 | Ga0466711_295708 | 3300042615 | Bacteria | 6099 |
| 52 | Ga0466718_095604 | 3300042617 | Bacteria | 3092 |
| 53 | Ga0466723_138127 | 3300042618 | Bacteria | 8692 |
| 54 | Ga0466728_077068 | 3300042620 | Bacteria | 3878 |
| 55 | Ga0466700_138502 | 3300042600 | Bacteria | 1044 |
| 56 | Ga0466700_222536 | 3300042600 | Bacteria | 2493 |
| 57 | Ga0466719_162511 | 3300042606 | Bacteria | 6458 |
| 58 | Ga0466720_048852 | 3300042607 | Bacteria | 2876 |
| 59 | Ga0466720_165671 | 3300042607 | Bacteria | 1086 |
| 60 | Ga0466690_273117 | 3300042590 | Bacteria | 14878 |
| 61 | Ga0466696_481146 | 3300042596 | Bacteria | 1413 |
| 62 | Ga0466699_048393 | 3300042597 | Bacteria | 18418 |
| 63 | Ga0466699_440887 | 3300042597 | Bacteria | 6318 |
| 64 | JGI24698J34947_10003440 | 3300002449 | Bacteria | 8585 |
| 65 | JGI24698J34947_10028438 | 3300002449 | Bacteria | 2959 |
| 66 | Ga0072941_1014457 | 3300005201 | Bacteria | 5515 |
| 67 | Ga0072941_1089550 | 3300005201 | Bacteria | 5021 |
| 68 | Ga0466735_188884 | 3300042624 | Bacteria | 1915 |
| 69 | Ga0466703_229115 | 3300042636 | Bacteria | 17432 |
| 70 | Ga0466704_034420 | 3300042643 | Bacteria | 35079 |
| 71 | Ga0466704_286043 | 3300042643 | Bacteria | 20073 |
| 72 | Ga0466704_318287 | 3300042643 | Bacteria | 3267 |
| 73 | Ga0466732_095546 | 3300042656 | Bacteria | 7691 |
| 74 | Ga0466732_364090 | 3300042656 | Bacteria | 10738 |
| 75 | Ga0466733_166717 | 3300042659 | Bacteria | 87248 |
| 76 | Ga0466712_045972 | 3300042614 | Bacteria | 9356 |
| 77 | Ga0466712_281667 | 3300042614 | Bacteria | 12480 |
| 78 | Ga0466723_012189 | 3300042618 | Bacteria | 1890 |
| 79 | Ga0466720_068846 | 3300042607 | Bacteria | 13130 |
| 80 | Ga0466721_318314 | 3300042608 | Bacteria | 1436 |
| 81 | Ga0466693_032207 | 3300042592 | Bacteria | 13948 |
| 82 | Ga0466691_219991 | 3300042593 | Bacteria | 33482 |
| 83 | Ga0466696_124653 | 3300042596 | Bacteria | 2961 |
| 84 | Ga0466699_116808 | 3300042597 | Bacteria | 1420 |
| 85 | Ga0466699_210403 | 3300042597 | Bacteria | 9117 |
| 86 | JGI24698J34947_10029901 | 3300002449 | Bacteria | 2875 |
| 87 | JGI24695J34938_10001871 | 3300002450 | Bacteria | 17095 |
| 88 | JGI24695J34938_10006888 | 3300002450 | Bacteria | 6747 |
| 89 | JGI24695J34938_10053167 | 3300002450 | Bacteria | 1763 |
| 90 | JGI24699J35502_11133970 | 3300002509 | Bacteria | 21986 |
| 91 | Ga0072941_1001475 | 3300005201 | Bacteria | 8505 |
| 92 | Ga0072941_1105249 | 3300005201 | Bacteria | 5897 |
| 93 | Ga0466729_250653 | 3300042621 | Bacteria | 2486 |
| 94 | Ga0466703_040188 | 3300042636 | Bacteria | 4838 |
| 95 | Ga0466727_177217 | 3300042655 | Bacteria | 2782 |
| 96 | Ga0466733_063690 | 3300042659 | Bacteria | 1636 |
| 97 | Ga0123355_10371531 | 3300009826 | Bacteria | 1873 |
| 98 | Ga0123356_10050509 | 3300010049 | Bacteria | 3869 |
| 99 | Ga0123356_10621285 | 3300010049 | Bacteria | 1246 |
| 100 | Ga0466712_012767 | 3300042614 | Bacteria | 18385 |
| 101 | Ga0466712_060583 | 3300042614 | Bacteria | 12544 |
| 102 | Ga0466712_128666 | 3300042614 | Bacteria | 4277 |
| 103 | Ga0466712_180234 | 3300042614 | Bacteria | 4497 |
| 104 | Ga0466715_104842 | 3300042616 | Bacteria | 2505 |
| 105 | Ga0466718_085804 | 3300042617 | Bacteria | 11821 |
| 106 | Ga0466716_088168 | 3300042605 | Bacteria | 5700 |
| 107 | Ga0466722_237965 | 3300042609 | Bacteria | 34947 |
| 108 | Ga0466692_142303 | 3300042591 | Bacteria | 11124 |
| 109 | Ga0466699_020661 | 3300042597 | Bacteria | 15510 |
| 110 | Ga0466699_284827 | 3300042597 | Bacteria | 14833 |
| 111 | AustNasuHG_c1000614 | 3300000089 | Bacteria | 12593 |
| 112 | AustNasuHG_c1002956 | 3300000089 | Bacteria | 6122 |
| 113 | JGI24698J34947_10016205 | 3300002449 | Bacteria | 4047 |
| 114 | JGI24698J34947_10016623 | 3300002449 | Bacteria | 3992 |
| 115 | JGI24698J34947_10021900 | 3300002449 | Bacteria | 3431 |
| 116 | JGI24697J35500_11204314 | 3300002507 | Unclassified | 1702 |
| 117 | Ga0072941_1048487 | 3300005201 | Bacteria | 6876 |
| 118 | Ga0466727_212472 | 3300042655 | Bacteria | 3113 |
| 119 | Ga0466732_298068 | 3300042656 | Bacteria | 8109 |
| 120 | Ga0123356_10004273 | 3300010049 | Bacteria | 14779 |
| 121 | Ga0466705_418742 | 3300042612 | Bacteria | 34230 |
| 122 | Ga0466712_113995 | 3300042614 | Bacteria | 6907 |
| 123 | Ga0466712_234863 | 3300042614 | Bacteria | 1451 |
| 124 | Ga0466718_156520 | 3300042617 | Bacteria | 1622 |
| 125 | Ga0466723_141806 | 3300042618 | Bacteria | 3289 |
| 126 | Ga0466728_107249 | 3300042620 | Bacteria | 2091 |
| 127 | Ga0466728_239247 | 3300042620 | Bacteria | 8122 |
| 128 | Ga0466728_368264 | 3300042620 | Bacteria | 9341 |
| 129 | Ga0466720_068780 | 3300042607 | Bacteria | 1978 |
| 130 | Ga0466720_115436 | 3300042607 | Bacteria | 52557 |
| 131 | Ga0466722_160542 | 3300042609 | Bacteria | 4586 |
| 132 | Ga0466722_220375 | 3300042609 | Bacteria | 6018 |
| 133 | Ga0466690_078176 | 3300042590 | Bacteria | 6264 |
| 134 | Ga0466691_028435 | 3300042593 | Bacteria | 5089 |
| 135 | Ga0466694_136825 | 3300042594 | Bacteria | 22203 |
| 136 | Ga0466699_070155 | 3300042597 | Bacteria | 13589 |
| 137 | AustNasuHG_c1000242 | 3300000089 | Bacteria | 18428 |
| 138 | JGI24695J34938_10000383 | 3300002450 | Bacteria | 43842 |
| 139 | Ga0072940_1012366 | 3300005200 | Bacteria | 8133 |
| 140 | Ga0072940_1033516 | 3300005200 | Bacteria | 1977 |
| 141 | Ga0072941_1000579 | 3300005201 | Bacteria | 109731 |
| 142 | Ga0466703_329215 | 3300042636 | Bacteria | 2809 |
| 143 | Ga0466704_211114 | 3300042643 | Bacteria | 5331 |
| 144 | Ga0466704_231113 | 3300042643 | Bacteria | 17132 |
| 145 | Ga0466727_193932 | 3300042655 | Bacteria | 3837 |
| 146 | Ga0466705_260067 | 3300042612 | Bacteria | 32862 |
| 147 | Ga0123353_10022188 | 3300010167 | Bacteria | 9560 |
| 148 | Ga0466712_100129 | 3300042614 | Bacteria | 8525 |
| 149 | Ga0466715_096475 | 3300042616 | Bacteria | 3586 |
| 150 | Ga0466723_240794 | 3300042618 | Bacteria | 12618 |
| 151 | Ga0466726_104416 | 3300042619 | Bacteria | 15969 |
| 152 | Ga0466706_032766 | 3300042599 | Bacteria | 2414 |
| 153 | Ga0466716_030075 | 3300042605 | Bacteria | 11493 |
| 154 | Ga0466716_105877 | 3300042605 | Bacteria | 2475 |
| 155 | Ga0466720_005056 | 3300042607 | Bacteria | 1491 |
| 156 | Ga0466720_084207 | 3300042607 | Bacteria | 2974 |
| 157 | Ga0466720_198047 | 3300042607 | Bacteria | 7116 |
| 158 | Ga0466720_216265 | 3300042607 | Bacteria | 17840 |
| 159 | Ga0466698_181172 | 3300042610 | Bacteria | 1776 |
| 160 | Ga0264413_113668 | 3300024493 | Bacteria | 13305 |
| 161 | Ga0466690_191541 | 3300042590 | Bacteria | 2266 |
| 162 | Ga0466692_148132 | 3300042591 | Bacteria | 2038 |
| 163 | Ga0466694_323807 | 3300042594 | Bacteria | 1060 |
| 164 | Ga0466699_002165 | 3300042597 | Bacteria | 10790 |
| 165 | Ga0466699_022748 | 3300042597 | Bacteria | 1672 |
| 166 | Ga0466699_238074 | 3300042597 | Bacteria | 1454 |
| 167 | Ga0466699_420987 | 3300042597 | Bacteria | 4811 |
| 168 | Ga0466699_431883 | 3300042597 | Bacteria | 26603 |
| 169 | JGI24698J34947_10000261 | 3300002449 | Bacteria | 22457 |
| 170 | JGI24698J34947_10002531 | 3300002449 | Bacteria | 9862 |
| 171 | JGI24698J34947_10004071 | 3300002449 | Bacteria | 7936 |
| 172 | JGI24698J34947_10012323 | 3300002449 | Bacteria | 4686 |
| 173 | JGI24695J34938_10001419 | 3300002450 | Bacteria | 20419 |
| 174 | JGI24695J34938_10007749 | 3300002450 | Bacteria | 6225 |
| 175 | Ga0072941_1048517 | 3300005201 | Bacteria | 4007 |
| 176 | Ga0072941_1083123 | 3300005201 | Unclassified | 2962 |
| 177 | Ga0072941_1108741 | 3300005201 | Bacteria | 7311 |
| 178 | Ga0466703_097237 | 3300042636 | Bacteria | 9615 |
| 179 | Ga0466704_617044 | 3300042643 | Bacteria | 5088 |
| 180 | Ga0466709_318034 | 3300042648 | Bacteria | 4651 |
| 181 | Ga0466708_078211 | 3300042652 | Bacteria | 46711 |
| 182 | Ga0123356_10155161 | 3300010049 | Bacteria | 2279 |
| 183 | Ga0466712_042651 | 3300042614 | Bacteria | 9830 |
| 184 | Ga0466712_225880 | 3300042614 | Bacteria | 7293 |
| 185 | Ga0466712_256060 | 3300042614 | Bacteria | 1462 |
| 186 | Ga0466707_018467 | 3300042601 | Bacteria | 4537 |
| 187 | Ga0466713_067680 | 3300042602 | Bacteria | 7133 |
| 188 | Ga0466720_086184 | 3300042607 | Bacteria | 5835 |
| 189 | Ga0466698_311902 | 3300042610 | Bacteria | 3609 |
| 190 | Ga0466698_358157 | 3300042610 | Bacteria | 4816 |
| 191 | Ga0466692_012116 | 3300042591 | Bacteria | 1653 |
| 192 | Ga0466699_094667 | 3300042597 | Bacteria | 5557 |
| 193 | Ga0466699_140170 | 3300042597 | Bacteria | 7515 |
| 194 | Ga0466699_155356 | 3300042597 | Bacteria | 11502 |
| 195 | Ga0466699_181525 | 3300042597 | Bacteria | 1114 |
| 196 | Ga0466699_209802 | 3300042597 | Bacteria | 4825 |
| 197 | Ga0466699_229331 | 3300042597 | Bacteria | 37974 |
| 198 | JGI24698J34947_10002718 | 3300002449 | Bacteria | 9552 |
| 199 | JGI24698J34947_10028573 | 3300002449 | Bacteria | 2952 |
| 200 | JGI24695J34938_10020578 | 3300002450 | Bacteria | 3244 |
| 201 | JGI24702J35022_10004971 | 3300002462 | Bacteria | 7845 |
| 202 | Ga0072940_1068683 | 3300005200 | Bacteria | 2018 |
| 203 | Ga0072941_1083713 | 3300005201 | Bacteria | 1957 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02911 | GO:0009058 | biosynthetic process | BP |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.