Protein Family IF01250
Metagenome
Isolate
146
Members
41
Samples
144
Scaffolds
72.51
Avg Length
Representative Sequence
- ID
- 3300005200|Ga0072940_1119965|Ga0072940_11199658
- Length
- 77 aa
- Sequence
- VIKVTEEMLDEYDFSNARPNPYARNLKKPVTIRLEASTIDYFKNLATKSAIPYQTLMNLYLADCAKNELQPSLAWS*
Sample Types
Isolate
1.4%
Metagenome
98.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
67.5%
Kalotermitidae
12.5%
Rhinotermitidae
7.5%
Termopsidae
5.0%
Unclassified
5.0%
Hodotermitidae
2.5%
Taxonomy
Archaea
0
Bacteria
107
Eukaryota
0
Viruses
1
Unclassified
38
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 3 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 4 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 5 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 6 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 7 | 2781125681 | Treponema sp. Lab288P1bin11 | Isolate | Unclassified |
| 8 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 9 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 10 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 11 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 12 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 13 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 14 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 15 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 16 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 17 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 18 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 19 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 20 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 21 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 22 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 23 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 24 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 25 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 26 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 27 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 28 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 29 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 30 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 31 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 32 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 33 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 34 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 35 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 36 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 37 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 38 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 39 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 40 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 41 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_079670 | 3300042659 | Bacteria | 1570 |
| 2 | Ga0466733_107264 | 3300042659 | Bacteria | 1498 |
| 3 | Ga0466733_185312 | 3300042659 | Bacteria | 20755 |
| 4 | Ga0466712_007804 | 3300042614 | Unclassified | 7005 |
| 5 | Ga0466712_259847 | 3300042614 | Bacteria | 1966 |
| 6 | Ga0466701_039379 | 3300042598 | Unclassified | 1013 |
| 7 | Ga0466706_129453 | 3300042599 | Bacteria | 9643 |
| 8 | Ga0466706_148784 | 3300042599 | Bacteria | 2005 |
| 9 | Ga0466706_234454 | 3300042599 | Bacteria | 2561 |
| 10 | Ga0466714_127300 | 3300042603 | Bacteria | 1199 |
| 11 | Ga0466698_085454 | 3300042610 | Bacteria | 2200 |
| 12 | Ga0123356_10020797 | 3300010049 | Bacteria | 6206 |
| 13 | Ga0123356_10124016 | 3300010049 | Bacteria | 2518 |
| 14 | Ga0123356_11023907 | 3300010049 | Unclassified | 995 |
| 15 | Ga0123353_11011119 | 3300010167 | Bacteria | 1116 |
| 16 | Ga0123353_11580950 | 3300010167 | Bacteria | 829 |
| 17 | Ga0123353_12479572 | 3300010167 | Unclassified | 618 |
| 18 | Ga0466696_097970 | 3300042596 | Bacteria | 1431 |
| 19 | Ga0466696_098152 | 3300042596 | Unclassified | 1191 |
| 20 | JGI24698J34947_10013767 | 3300002449 | Bacteria | 4406 |
| 21 | JGI24698J34947_10104378 | 3300002449 | Unclassified | 1266 |
| 22 | JGI24695J34938_10489264 | 3300002450 | Bacteria | 561 |
| 23 | JGI24702J35022_10279796 | 3300002462 | Bacteria | 979 |
| 24 | JGI24705J35276_11366609 | 3300002504 | Bacteria | 518 |
| 25 | Ga0068302_10590119 | 3300005071 | Bacteria | 1129 |
| 26 | Ga0466733_190824 | 3300042659 | Bacteria | 2156 |
| 27 | Ga0466726_265693 | 3300042619 | Bacteria | 1142 |
| 28 | Ga0466706_209862 | 3300042599 | Bacteria | 2752 |
| 29 | Ga0466720_157368 | 3300042607 | Unclassified | 7481 |
| 30 | Ga0123357_10321402 | 3300009784 | Bacteria | 1528 |
| 31 | Ga0123355_10043321 | 3300009826 | Bacteria | 7322 |
| 32 | Ga0123356_12202592 | 3300010049 | Bacteria | 689 |
| 33 | Ga0123356_13040745 | 3300010049 | Bacteria | 585 |
| 34 | Ga0415639_082355 | 3300038395 | Bacteria | 2588 |
| 35 | Ga0466690_093990 | 3300042590 | Bacteria | 3137 |
| 36 | Ga0466699_395725 | 3300042597 | Bacteria | 1622 |
| 37 | JGI24698J34947_10119828 | 3300002449 | Bacteria | 1144 |
| 38 | JGI24695J34938_10546205 | 3300002450 | Bacteria | 534 |
| 39 | Ga0466706_230019 | 3300042599 | Bacteria | 1328 |
| 40 | Ga0123356_10081315 | 3300010049 | Viruses | 3065 |
| 41 | Ga0123356_10924468 | 3300010049 | Bacteria | 1043 |
| 42 | Ga0123356_11260274 | 3300010049 | Unclassified | 904 |
| 43 | Ga0123356_12130839 | 3300010049 | Unclassified | 700 |
| 44 | Ga0123353_11339983 | 3300010167 | Bacteria | 926 |
| 45 | Ga0123354_10272083 | 3300010882 | Bacteria | 1665 |
| 46 | Ga0123354_10465464 | 3300010882 | Unclassified | 1012 |
| 47 | Ga0466692_015940 | 3300042591 | Unclassified | 2218 |
| 48 | Ga0466693_264588 | 3300042592 | Bacteria | 1730 |
| 49 | Ga0466696_200097 | 3300042596 | Bacteria | 1149 |
| 50 | JGI24698J34947_10010908 | 3300002449 | Bacteria | 4985 |
| 51 | JGI24698J34947_10056663 | 3300002449 | Bacteria | 1947 |
| 52 | JGI24696J40584_12528187 | 3300002834 | Bacteria | 613 |
| 53 | Ga0072941_1036125 | 3300005201 | Bacteria | 2930 |
| 54 | Ga0466733_141867 | 3300042659 | Bacteria | 123412 |
| 55 | Ga0466712_002915 | 3300042614 | Bacteria | 1993 |
| 56 | Ga0466712_309210 | 3300042614 | Bacteria | 1664 |
| 57 | Ga0466718_152801 | 3300042617 | Bacteria | 1503 |
| 58 | Ga0466731_133713 | 3300042622 | Bacteria | 1351 |
| 59 | Ga0466717_039088 | 3300042604 | Bacteria | 2820 |
| 60 | Ga0123356_10495284 | 3300010049 | Unclassified | 1377 |
| 61 | Ga0123356_11525186 | 3300010049 | Unclassified | 825 |
| 62 | Ga0123353_10683951 | 3300010167 | Bacteria | 1444 |
| 63 | Ga0123353_11651693 | 3300010167 | Bacteria | 806 |
| 64 | Ga0123353_11936049 | 3300010167 | Bacteria | 725 |
| 65 | Ga0466695_139721 | 3300042595 | Bacteria | 2322 |
| 66 | AustNasuHG_c1003003 | 3300000089 | Bacteria | 6089 |
| 67 | JGI24698J34947_10032582 | 3300002449 | Bacteria | 2736 |
| 68 | JGI24698J34947_10047029 | 3300002449 | Unclassified | 2192 |
| 69 | JGI24698J34947_10108410 | 3300002449 | Unclassified | 1231 |
| 70 | JGI24695J34938_10011057 | 3300002450 | Unclassified | 4890 |
| 71 | JGI24705J35276_12127794 | 3300002504 | Bacteria | 1094 |
| 72 | JGI24696J40584_12947561 | 3300002834 | Bacteria | 1954 |
| 73 | Ga0466712_002362 | 3300042614 | Bacteria | 5758 |
| 74 | Ga0466712_207012 | 3300042614 | Unclassified | 1857 |
| 75 | Ga0466715_290393 | 3300042616 | Bacteria | 6008 |
| 76 | Ga0466718_021942 | 3300042617 | Unclassified | 1297 |
| 77 | Ga0466726_294600 | 3300042619 | Bacteria | 2374 |
| 78 | Ga0466731_098074 | 3300042622 | Bacteria | 9759 |
| 79 | Ga0466698_356486 | 3300042610 | Bacteria | 1310 |
| 80 | Ga0123357_10047927 | 3300009784 | Bacteria | 5791 |
| 81 | Ga0123356_10287274 | 3300010049 | Bacteria | 1743 |
| 82 | Ga0123356_11220971 | 3300010049 | Unclassified | 917 |
| 83 | Ga0123354_10017193 | 3300010882 | Bacteria | 11330 |
| 84 | JGI24702J35022_10392736 | 3300002462 | Bacteria | 836 |
| 85 | JGI24699J35502_10744623 | 3300002509 | Unclassified | 811 |
| 86 | Ga0072941_1057168 | 3300005201 | Bacteria | 1178 |
| 87 | Ga0466712_003154 | 3300042614 | Unclassified | 1493 |
| 88 | Ga0466712_161694 | 3300042614 | Bacteria | 1664 |
| 89 | Ga0466718_069406 | 3300042617 | Bacteria | 11722 |
| 90 | Ga0466728_119078 | 3300042620 | Bacteria | 1887 |
| 91 | Ga0466706_124721 | 3300042599 | Unclassified | 1060 |
| 92 | Ga0466706_141308 | 3300042599 | Unclassified | 8966 |
| 93 | Ga0123355_10848013 | 3300009826 | Unclassified | 1006 |
| 94 | Ga0123356_10563722 | 3300010049 | Bacteria | 1301 |
| 95 | Ga0123356_11692864 | 3300010049 | Bacteria | 784 |
| 96 | Ga0123356_13845828 | 3300010049 | Bacteria | 518 |
| 97 | Ga0123353_10838896 | 3300010167 | Unclassified | 1262 |
| 98 | Ga0123354_10976644 | 3300010882 | Bacteria | 547 |
| 99 | Ga0466696_224515 | 3300042596 | Bacteria | 2717 |
| 100 | Ga0466699_412690 | 3300042597 | Unclassified | 5904 |
| 101 | JGI24698J34947_10184067 | 3300002449 | Bacteria | 832 |
| 102 | JGI24695J34938_10019659 | 3300002450 | Unclassified | 3340 |
| 103 | JGI24695J34938_10311850 | 3300002450 | Unclassified | 682 |
| 104 | JGI24702J35022_10007985 | 3300002462 | Bacteria | 6023 |
| 105 | Ga0466712_074541 | 3300042614 | Bacteria | 1484 |
| 106 | Ga0466712_098690 | 3300042614 | Unclassified | 1765 |
| 107 | Ga0466715_023520 | 3300042616 | Bacteria | 9983 |
| 108 | Ga0466715_304627 | 3300042616 | Unclassified | 4462 |
| 109 | Ga0466731_277310 | 3300042622 | Bacteria | 1287 |
| 110 | Ga0466706_254054 | 3300042599 | Bacteria | 46518 |
| 111 | Ga0466722_224748 | 3300042609 | Unclassified | 1653 |
| 112 | Ga0466697_032670 | 3300042611 | Bacteria | 1751 |
| 113 | Ga0123357_10225596 | 3300009784 | Bacteria | 2067 |
| 114 | Ga0123356_12704086 | 3300010049 | Bacteria | 621 |
| 115 | Ga0123356_13536305 | 3300010049 | Bacteria | 541 |
| 116 | Ga0415639_148553 | 3300038395 | Bacteria | 1974 |
| 117 | Ga0466696_127025 | 3300042596 | Bacteria | 1009 |
| 118 | JGI24695J34938_10188075 | 3300002450 | Bacteria | 857 |
| 119 | JGI24702J35022_10070125 | 3300002462 | Bacteria | 1886 |
| 120 | Ga0072940_1046050 | 3300005200 | Bacteria | 3477 |
| 121 | Ga0072940_1229324 | 3300005200 | Bacteria | 866 |
| 122 | Ga0466712_173131 | 3300042614 | Bacteria | 4901 |
| 123 | Ga0466718_094989 | 3300042617 | Bacteria | 1139 |
| 124 | Ga0466729_296536 | 3300042621 | Unclassified | 1052 |
| 125 | Ga0466731_025987 | 3300042622 | Bacteria | 1331 |
| 126 | Ga0466731_297099 | 3300042622 | Bacteria | 2048 |
| 127 | Ga0466706_187148 | 3300042599 | Bacteria | 2542 |
| 128 | Ga0466717_133568 | 3300042604 | Bacteria | 1380 |
| 129 | Ga0123357_10052443 | 3300009784 | Unclassified | 5508 |
| 130 | Ga0123356_10001635 | 3300010049 | Bacteria | 24595 |
| 131 | Ga0123356_10171298 | 3300010049 | Bacteria | 2182 |
| 132 | Ga0123356_10324706 | 3300010049 | Bacteria | 1653 |
| 133 | Ga0123356_10400325 | 3300010049 | Unclassified | 1510 |
| 134 | Ga0123356_10502611 | 3300010049 | Bacteria | 1368 |
| 135 | Ga0123356_12132602 | 3300010049 | Bacteria | 700 |
| 136 | Ga0123356_12428283 | 3300010049 | Unclassified | 656 |
| 137 | Ga0123356_13371972 | 3300010049 | Bacteria | 555 |
| 138 | Ga0466691_015397 | 3300042593 | Bacteria | 1572 |
| 139 | Ga0466701_012808 | 3300042598 | Bacteria | 1728 |
| 140 | JGI24698J34947_10013439 | 3300002449 | Bacteria | 4471 |
| 141 | JGI24698J34947_10156744 | 3300002449 | Unclassified | 938 |
| 142 | JGI24702J35022_10430490 | 3300002462 | Unclassified | 801 |
| 143 | JGI24705J35276_12170909 | 3300002504 | Unclassified | 1292 |
| 144 | Ga0072940_1119965 | 3300005200 | Bacteria | 3405 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.