Protein Family IF01246

Metagenome Isolate
149 Members
99 Samples
93 Scaffolds
209 Avg Length

🧬 Representative Sequence

ID
3300005200|Ga0072940_1084673|Ga0072940_10846731
Length
247 aa
Sequence
MPAAGITIATPTLAVASLGHSAGQSDRALHGPSAPQAADLKSEGQGFGLTDSIYNRLLKERIIWLGSEVRDDNANAICAQMMLLAAEDPDKDIWLYINSPGGSITAGMAIYDTMQYIQPDVATVAMGMAASMGQFLLSSGAKGKRYATPHTRVLMHQPSGGFGGTATDVRINAQLIMHMKQTLAQLTAEQTGQPLERILKDNDRDHWFTAPEALEYGFIDHVVEKAALAGGGGMSAGTPDAEAADK*

📊 Sample Types

Isolate 37.6%
Metagenome 62.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 27.1%
Termitidae 15.6%
Formicidae 14.6%
Kalotermitidae 11.5%
Tenebrionidae 6.2%
Cambaridae 5.2%
Scarabaeidae 3.1%
Culicidae 3.1%
Armadillidiidae 3.1%
Hydrophilidae 2.1%
Rhinotermitidae 1.0%
Thomisidae 1.0%
Hodotermitidae 1.0%
Reduviidae 1.0%
Cerambycidae 1.0%
Pentatomidae 1.0%
Pyralidae 1.0%
Curculionidae 1.0%

🌳 Taxonomy

Archaea 0
Bacteria 138
Eukaryota 0
Viruses 0
Unclassified 11

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2675903497 Pseudonocardia sp. EC080610-09 Isolate Formicidae
2 2681812870 Oerskovia enterophila DFA-19 Isolate Unclassified
3 2820909719 Unclassified Actinobacteria Emb289P4bin20 Isolate Unclassified
4 2848356102 Xylanimonas allomyrinae 2JSPR-7 Isolate Scarabaeidae
5 2856966858 Pseudonocardia sp. Ae263_Ps1 Isolate Formicidae
6 2910090113 Kocuria sp. cx-116 Isolate Cambaridae
7 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
8 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
9 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
10 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
11 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
12 2731957681 Xylanimicrobium pachnodae JCM 13526, NBRC 107786 Isolate Scarabaeidae
13 2852016966 Micromonospora polyrhachis DSM 45886 Isolate Unclassified
14 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
15 3300012815 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG Metagenome
16 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
17 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
18 2504756063 Isoptericola variabilis J5 Isolate Unclassified
19 2630969010 Friedmanniella luteola DSM 21741 Isolate Thomisidae
20 2734481968 Xylanimicrobium pachnodae JCM 13526, NBRC 107786 Isolate Scarabaeidae
21 2820935937 Unclassified Actinobacteria Emb289P1bin40 Isolate Unclassified
22 2820944107 Unclassified Actinobacteria Cu122P5bin14 Isolate Unclassified
23 2856882415 Pseudonocardia sp. Ae406_Ps2 Isolate Formicidae
24 2859977607 Pseudonocardia sp. Ae707_Ps1 Isolate Formicidae
25 2873589062 Phycicoccus sp. HDW14 Isolate Hydrophilidae
26 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
27 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
28 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
29 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
30 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
31 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
32 8109397740 Rhodococcus triatomae DSM 44892 Isolate Unclassified
33 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
34 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
35 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
36 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
37 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
38 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
39 2547132042 Pseudonocardia sp. P2 Isolate Formicidae
40 2718217924 Pseudonocardia sp. HH130630-07 Isolate Formicidae
41 2772190761 Rhodococcus rhodnii NRRL B-16535 Isolate Unclassified
42 2820803007 Unclassified Actinobacteria Th196P3bin61 Isolate Unclassified
43 2820838073 Unclassified Actinobacteria Lab288P4bin27 Isolate Unclassified
44 2820842553 Unclassified Actinobacteria Lab288P4bin104 Isolate Unclassified
45 2820929059 Unclassified Actinobacteria Emb289P3bin110 Isolate Unclassified
46 2821314491 Unclassified Actinobacteria Lab288P4bin49 Isolate Unclassified
47 2856960404 Pseudonocardia sp. Ae706_Ps2 Isolate Formicidae
48 2856973192 Pseudonocardia sp. Ae331_Ps2 Isolate Formicidae
49 2859970369 Pseudonocardia sp. Ae717_Ps2 Isolate Formicidae
50 2863397684 Micromonospora polyrhachis DSM 45886 (Annotation) (version 2) Isolate Unclassified
51 2909412500 Yimella sp. cx-573 Isolate Cambaridae
52 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
53 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
54 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
55 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
56 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
57 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
58 2545824723 Rhodococcus rhodnii LMG 5362 Isolate Reduviidae
59 2820825283 Unclassified Actinobacteria Nt197P3bin111 Isolate Unclassified
60 2820911766 Unclassified Actinobacteria Emb289P3bin96 Isolate Unclassified
61 2883361506 Luteimicrobium xylanilyticum HY-24 Isolate Cerambycidae
62 2909881144 Kocuria sp. cx-455 Isolate Cambaridae
63 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
64 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
65 8012935351 Brevibacterium epidermidis UD i117 Isolate Unclassified
66 8067071256 Microbispora camponoti 2C-HV3 Isolate Formicidae
67 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
68 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
69 2505679068 Isoptericola variabilis 225 Isolate Unclassified
70 2671180625 Pseudonocardia sp. EC080619-01 Isolate Formicidae
71 2675903013 Rhodococcus triatomae DSM 44892 Isolate Unclassified
72 2820849606 Unclassified Actinobacteria Lab288P3bin39 Isolate Unclassified
73 2820926697 Unclassified Actinobacteria Emb289P3bin125 Isolate Unclassified
74 2873586004 Sanguibacter sp. HDW7 Isolate Hydrophilidae
75 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
76 8062637095 Yimella sp. cx-51 Isolate Cambaridae
77 3300012818 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG Metagenome
78 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
79 2818991478 Micromonospora palomenae DSM 102131 Isolate Pentatomidae
80 2820867525 Unclassified Actinobacteria Lab288P3bin128 Isolate Unclassified
81 2856954254 Pseudonocardia sp. Ae505_Ps2 Isolate Formicidae
82 2884351759 Cellulosimicrobium sp. BI34T Isolate Pyralidae
83 8062747827 Yimella sp. cx-51 Isolate Cambaridae
84 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
85 3300012806 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG Metagenome
86 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
87 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
88 2820897376 Unclassified Actinobacteria Lab288P1bin101 Isolate Unclassified
89 2856671350 Pseudonocardia sp. Ae356_Ps1 Isolate Formicidae
90 2856947901 Pseudonocardia sp. Ae168_Ps1 Isolate Formicidae
91 2918390780 Glutamicibacter protophormiae DSM 20168 Isolate Unclassified
92 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
93 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
94 8069511479 Arthrobacter ipsi IA7 Isolate Curculionidae
95 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
96 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
97 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
98 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
99 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_031846 3300042612 Bacteria 3564
2 Ga0562375_0373 3300056856 Unclassified 100787
3 Ga0562376_0789 3300056857 Bacteria 51414
4 Ga0466723_288161 3300042618 Bacteria 7198
5 Ga0466723_305617 3300042618 Bacteria 3267
6 Ga0466728_167944 3300042620 Bacteria 1171
7 Ga0466707_309978 3300042601 Bacteria 16368
8 Ga0466713_033429 3300042602 Bacteria 27281
9 Ga0123353_10176856 3300010167 Bacteria 3383
10 Ga0123354_10118876 3300010882 Bacteria 3428
11 Ga0072940_1084673 3300005200 Bacteria 878
12 Ga0466703_072346 3300042636 Bacteria 156211
13 Ga0160468_111974 3300012819 Bacteria 819
14 Ga0160443_100252 3300012848 Bacteria 56331
15 Ga0160447_102912 3300012849 Bacteria 5743
16 Ga0466705_352135 3300042612 Bacteria 6315
17 Ga0562376_0113 3300056857 Bacteria 183281
18 Ga0123357_10072688 3300009784 Bacteria 4557
19 Ga0123356_10028990 3300010049 Unclassified 5186
20 Ga0123356_10031881 3300010049 Bacteria 4932
21 Ga0123353_10000728 3300010167 Bacteria 40136
22 JGI24699J35502_11134059 3300002509 Bacteria 27570
23 Ga0466708_174391 3300042652 Bacteria 8893
24 Ga0466725_419199 3300042654 Bacteria 2059
25 Ga0160472_100012 3300012839 Bacteria 433895
26 Ga0466693_204487 3300042592 Bacteria 8581
27 Ga0466705_385115 3300042612 Bacteria 7034
28 Ga0562376_1511 3300056857 Bacteria 32176
29 Ga0466718_163680 3300042617 Bacteria 7561
30 Ga0466723_339538 3300042618 Bacteria 5646
31 Ga0466728_183862 3300042620 Bacteria 1195
32 Ga0466706_131529 3300042599 Bacteria 7890
33 Ga0123356_10001422 3300010049 Bacteria 26473
34 Ga0160442_100013 3300012806 Bacteria 424413
35 JGI24703J35330_11716197 3300002501 Bacteria 2279
36 Ga0466708_047907 3300042652 Bacteria 31421
37 Ga0466691_064500 3300042593 Bacteria 4494
38 Ga0562379_0375 3300056790 Bacteria 102463
39 Ga0562378_0214 3300056814 Unclassified 138321
40 Ga0562377_0297 3300056842 Bacteria 104094
41 Ga0562375_0028 3300056856 Bacteria 708255
42 Ga0562376_3438 3300056857 Bacteria 15883
43 Ga0466723_060842 3300042618 Bacteria 35094
44 Ga0466723_280997 3300042618 Bacteria 1612
45 Ga0123357_10027130 3300009784 Unclassified 7738
46 Ga0123354_10034665 3300010882 Unclassified 7890
47 Ga0072940_1084672 3300005200 Unclassified 1910
48 Ga0466703_238548 3300042636 Bacteria 10421
49 Ga0466704_122764 3300042643 Bacteria 12234
50 Ga0466696_147952 3300042596 Bacteria 3170
51 Ga0562379_0008 3300056790 Bacteria 1928858
52 Ga0562375_0051 3300056856 Bacteria 467539
53 Ga0562375_0295 3300056856 Bacteria 125606
54 Ga0562375_2072 3300056856 Bacteria 23773
55 Ga0562376_0027 3300056857 Bacteria 397453
56 Ga0466707_151207 3300042601 Bacteria 1466
57 Ga0466713_058497 3300042602 Bacteria 3432
58 Ga0123355_10863173 3300009826 Bacteria 993
59 Ga0123356_10039931 3300010049 Unclassified 4372
60 Ga0123356_10252583 3300010049 Bacteria 1842
61 Ga0072940_1077265 3300005200 Bacteria 7399
62 Ga0160432_101830 3300012818 Bacteria 5723
63 Ga0466696_479568 3300042596 Bacteria 2899
64 Ga0562375_0307 3300056856 Bacteria 120979
65 Ga0466715_343342 3300042616 Bacteria 53918
66 Ga0466719_382230 3300042606 Bacteria 59148
67 Ga0123356_10006222 3300010049 Bacteria 12065
68 Ga0160432_100186 3300012818 Bacteria 54846
69 Ga0466657_132024 3300042582 Bacteria 1047
70 Ga0466691_143852 3300042593 Bacteria 13971
71 Ga0562375_0006 3300056856 Bacteria 2261894
72 Ga0562376_3773 3300056857 Unclassified 14441
73 Ga0466715_505065 3300042616 Bacteria 2541
74 Ga0466723_242381 3300042618 Bacteria 71488
75 Ga0466729_020127 3300042621 Bacteria 2131
76 Ga0466719_008939 3300042606 Bacteria 3150
77 Ga0123357_10008561 3300009784 Unclassified 12798
78 AustNasuHG_c1000081 3300000089 Bacteria 27217
79 Ga0466734_123697 3300042623 Bacteria 1119
80 Ga0466730_073912 3300042625 Bacteria 1002
81 Ga0160457_1000017 3300012858 Bacteria 384973
82 Ga0530661_037199 3300056564 Unclassified 1412
83 Ga0562377_3061 3300056842 Unclassified 9897
84 Ga0562375_1461 3300056856 Bacteria 31736
85 Ga0466715_597961 3300042616 Bacteria 2437
86 Ga0466723_133512 3300042618 Bacteria 8021
87 Ga0466716_082489 3300042605 Bacteria 33521
88 Ga0123356_10000416 3300010049 Bacteria 48609
89 Ga0123354_10220302 3300010882 Bacteria 2019
90 JGI24699J35502_11126284 3300002509 Bacteria 3936
91 Ga0160440_103196 3300012815 Bacteria 1611
92 Ga0160434_100040 3300012850 Bacteria 105246
93 Ga0466696_079004 3300042596 Bacteria 4186

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00574 CLP_protease Clp protease 51 225 0.99

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.