Protein Family IF01234

Metagenome Isolate
269 Members
156 Samples
171 Scaffolds
557.49 Avg Length

🧬 Representative Sequence

ID
3300005200|Ga0072940_1021602|Ga0072940_10216028
Length
615 aa
Sequence
VAEFIYQMYKARKAHGDKVILDDVSLNFLPGAKIGVVGPNGAGKSTILKIMAGLDKPSNGEARLAPGYSVGILQQEPPLNEDKTVLGNIEEAVADIKAKLNRYNEISELMADPDADFDALLAEMGELQEEIDAADAWELDSQLEQAMDALRCPPSDMPVSVLSGGERRRVALCKLLLEKPDLLLLDEPTNHLDAESVQWLEQHLANYPGAILAVTHDRYFLDHVAEWICEVDRGRLYPYEGNYTTYLEKKQERLQVQGKKDAKLAKRLKDELEWVRSNAKGRQAKSKARLQRYEEMANEAERTRKLDFEEIQIPNGPRLGNVVLEAKNLEKGFDDRTLIDGLSFTLPKNGIVGVIGPNGVGKTTLFKSIVGLEELDGGELKIGDTVKISYVDQGRGGIDPKKTLWEVVSDGLDFIKVGNQEIPSRAYVASFGFKGPDQQKPAGVLSGGERNRLNLALTLKQGGNLLLLDEPTNDLDVETLGSLENALLEFPGCAVVVSHDRWFLDRVATHILAYEGNDDDPANWYWFEGNFAAYEENXXRPLVPGPGGHAHPCLRGQRRRSGQLVLVRGQLRRLRGKQPSHIPQADQGLGPSVECGEAVYRDHGHRKWPDPALR*

📊 Sample Types

Isolate 36.4%
Metagenome 63.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 37.2%
Termitidae 18.2%
Kalotermitidae 8.8%
Formicidae 6.1%
Apidae 5.4%
Culicidae 3.4%
Scarabaeidae 2.7%
Elmidae 2.7%
Tenebrionidae 2.7%
Dytiscidae 2.0%
Hydrophilidae 1.4%
Cambaridae 1.4%
Rhinotermitidae 1.4%
Termopsidae 1.4%
Chironomidae 0.7%
Curculionidae 0.7%
Pentatomidae 0.7%
Pyralidae 0.7%
Cerambycidae 0.7%
Thomisidae 0.7%
Hodotermitidae 0.7%
Siricidae 0.7%

🌳 Taxonomy

Archaea 0
Bacteria 250
Eukaryota 0
Viruses 0
Unclassified 19

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2505679068 Isoptericola variabilis 225 Isolate Unclassified
2 2671180625 Pseudonocardia sp. EC080619-01 Isolate Formicidae
3 2820171952 Unclassified Planctomycetes Th196P3bin88 Isolate Unclassified
4 2820807258 Unclassified Actinobacteria Nt197P3bin90 Isolate Unclassified
5 2820818506 Unclassified Actinobacteria Nt197P3bin3 Isolate Unclassified
6 2820849606 Unclassified Actinobacteria Lab288P3bin39 Isolate Unclassified
7 2820889385 Unclassified Actinobacteria Lab288P1bin133 Isolate Unclassified
8 2820922474 Unclassified Actinobacteria Emb289P3bin154 Isolate Unclassified
9 2820926697 Unclassified Actinobacteria Emb289P3bin125 Isolate Unclassified
10 2865982043 Bifidobacterium aemilianum XV10 Isolate Apidae
11 2873586004 Sanguibacter sp. HDW7 Isolate Hydrophilidae
12 2915166107 Leucobacter sp. cx-87 Isolate Cambaridae
13 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
14 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
15 3300012818 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG Metagenome
16 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
17 8077775691 Tsukamurella sp. PLM1 Isolate Formicidae
18 8077783556 Streptomyces sp. PLM4 Isolate Formicidae
19 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
20 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
21 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
22 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
23 8110340172 Bifidobacterium choladohabitans B14384H11 Isolate Apidae
24 2515154100 Streptomyces sp. MspMP-M5 Isolate Unclassified
25 2515154104 Streptomyces sp. KhCrAH-244 Isolate Unclassified
26 2524023214 Leucobacter chironomi DSM 19883 Isolate Chironomidae
27 2597490239 Bifidobacterium bohemicum DSM 22767 Isolate Unclassified
28 2675903497 Pseudonocardia sp. EC080610-09 Isolate Formicidae
29 2681812870 Oerskovia enterophila DFA-19 Isolate Unclassified
30 2820909719 Unclassified Actinobacteria Emb289P4bin20 Isolate Unclassified
31 2820914081 Unclassified Actinobacteria Emb289P3bin87 Isolate Unclassified
32 2848356102 Xylanimonas allomyrinae 2JSPR-7 Isolate Scarabaeidae
33 2896955351 Streptomyces sp. GF20 Isolate Termitidae
34 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
35 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
36 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
37 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
38 647000328 Streptomyces sp. ACT-1 XylebKG-1 Isolate Curculionidae
39 8053361298 Streptomyces formicae 1H-GS9 Isolate Unclassified
40 8067987626 Agromyces larvae CFWR-12 Isolate Unclassified
41 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
42 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
43 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
44 2818991478 Micromonospora palomenae DSM 102131 Isolate Pentatomidae
45 2820178484 Unclassified Planctomycetes Th196P3bin110 Isolate Unclassified
46 2820809073 Unclassified Actinobacteria Nt197P3bin55 Isolate Unclassified
47 2820903739 Unclassified Actinobacteria Emb289P4bin49 Isolate Unclassified
48 2820931684 Unclassified Actinobacteria Emb289P1bin89 Isolate Unclassified
49 2841168549 Agromyces protaetiae FW100M-8 Isolate Scarabaeidae
50 2864918810 Tsukamurella ocularis S00175 Isolate Elmidae
51 2873614151 Leucobacter viscericola HDW9C Isolate Dytiscidae
52 2879643867 Bifidobacterium sp. wkB344 Isolate Apidae
53 2884351759 Cellulosimicrobium sp. BI34T Isolate Pyralidae
54 2912749649 Streptomyces sp. GS7 Isolate Termitidae
55 3006461590 Streptomyces sp. RB5 Isolate Termitidae
56 3006667155 Streptomyces sp. SID9727 Isolate
57 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
58 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
59 2684622918 Bifidobacterium asteroides Bi_198 Isolate Unclassified
60 2820168331 Unclassified Proteobacteria Co191P3bin57 Isolate Unclassified
61 2820201435 Unclassified Planctomycetes Cu122P5bin25 Isolate Unclassified
62 2820820509 Unclassified Actinobacteria Nt197P3bin23 Isolate Unclassified
63 2864899338 Mycobacteroides chelonae S00154 Isolate Elmidae
64 2873196663 Streptomyces capitiformicae 1H-SSA4 Isolate Formicidae
65 2908241010 Streptomyces sp. HF10 Isolate Termitidae
66 2912817845 Streptomyces griseus SID164 Isolate
67 3006468911 Streptomyces sp. RB17 Isolate Termitidae
68 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
69 8024981139 Bifidobacterium asteroides ESL0170 Isolate Apidae
70 8030347546 Propionimicrobium sp. PCR01-08-3 Isolate Tenebrionidae
71 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
72 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
73 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
74 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
75 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
76 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
77 2515154106 Streptomyces sp. FxanaD5 Isolate Unclassified
78 2808606957 Bifidobacterium sp. ESL0447 Isolate Unclassified
79 2820166269 Unclassified Proteobacteria Co191P4bin16 Isolate Unclassified
80 2820185449 Unclassified Planctomycetes Lab288P3bin146 Isolate Unclassified
81 2820217359 Unclassified Kiritimatiellaeota Nt197P3bin101 Isolate Unclassified
82 2820803007 Unclassified Actinobacteria Th196P3bin61 Isolate Unclassified
83 2820838073 Unclassified Actinobacteria Lab288P4bin27 Isolate Unclassified
84 2820842553 Unclassified Actinobacteria Lab288P4bin104 Isolate Unclassified
85 2821314491 Unclassified Actinobacteria Lab288P4bin49 Isolate Unclassified
86 2862784999 Streptomyces sp. M41 Isolate Unclassified
87 2864773010 Tsukamurella ocularis S00022 Isolate Elmidae
88 2931425734 Nocardioides sp. J2M5 Isolate
89 2931430189 Tessaracoccus palaemonis J1M15 Isolate
90 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
91 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
92 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
93 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
94 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
95 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
96 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
97 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
98 2684622916 Bifidobacterium asteroides Bi_170 Isolate Unclassified
99 2684622917 Bifidobacterium coryneforme Bi_197 Isolate Unclassified
100 2820825283 Unclassified Actinobacteria Nt197P3bin111 Isolate Unclassified
101 2820829137 Unclassified Actinobacteria Nc150P5bin2 Isolate Unclassified
102 2820911766 Unclassified Actinobacteria Emb289P3bin96 Isolate Unclassified
103 2873620646 Leucobacter coleopterorum HDW9A Isolate Dytiscidae
104 2883361506 Luteimicrobium xylanilyticum HY-24 Isolate Cerambycidae
105 3300007733 Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean Metagenome
106 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
107 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
108 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
109 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
110 2504756063 Isoptericola variabilis J5 Isolate Unclassified
111 2630969010 Friedmanniella luteola DSM 21741 Isolate Thomisidae
112 2648501322 Streptomyces sp. SA3_actF Isolate Unclassified
113 2820170025 Unclassified Proteobacteria Co191P1bin43 Isolate Unclassified
114 2820205024 Unclassified Planctomycetes Cu122P4bin3 Isolate Unclassified
115 2820814774 Unclassified Actinobacteria Nt197P3bin39 Isolate Unclassified
116 2820816657 Unclassified Actinobacteria Nt197P3bin38 Isolate Unclassified
117 2820901319 Unclassified Actinobacteria Emb289P4bin58 Isolate Unclassified
118 2864964650 Tsukamurella ocularis S00236 Isolate Elmidae
119 2873558832 Propioniciclava coleopterorum HDW11 Isolate Hydrophilidae
120 2884613238 Agromyces intestinalis KACC 19306 Isolate Scarabaeidae
121 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
122 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
123 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
124 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
125 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
126 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
127 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
128 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
129 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
130 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
131 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
132 8046957834 Streptomyces coacervatus JCM 17138 Isolate Unclassified
133 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
134 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
135 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
136 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
137 2523533511 Streptomyces sp. Sv. ACTE SirexAA-E Isolate Siricidae
138 2568526170 Bifidobacterium sp. A11 Isolate Apidae
139 2731957681 Xylanimicrobium pachnodae JCM 13526, NBRC 107786 Isolate Scarabaeidae
140 2818991320 Klugiella xanthotipulae DSM 18031 Isolate Unclassified
141 2820134530 Unclassified Proteobacteria Emb289P3bin65 Isolate Unclassified
142 2820834831 Unclassified Actinobacteria Lab288P4bin79 Isolate Unclassified
143 2820840446 Unclassified Actinobacteria Lab288P4bin17 Isolate Unclassified
144 2820863028 Unclassified Actinobacteria Lab288P3bin164 Isolate Unclassified
145 2873617540 Leucobacter insecticola HDW9B Isolate Dytiscidae
146 2915168811 Leucobacter sp. cx-169 Isolate Cambaridae
147 3002678670 Agromyces sp. G127AT Isolate Unclassified
148 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
149 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
150 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
151 8024986378 Bifidobacterium asteroides ESL0198 Isolate Apidae
152 8032009961 Bifidobacterium indicum ESL0197 Isolate Apidae
153 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
154 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
155 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
156 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123353_10001402 3300010167 Bacteria 29472
2 Ga0123353_10017885 3300010167 Bacteria 10451
3 Ga0123354_10003479 3300010882 Bacteria 21762
4 Ga0160453_101807 3300012814 Unclassified 6371
5 Ga0466693_092506 3300042592 Bacteria 47251
6 Ga0466696_143954 3300042596 Bacteria 5263
7 AustNasuHG_c1000578 3300000089 Unclassified 12918
8 JGI24699J35502_11132795 3300002509 Unclassified 7626
9 Ga0072940_1036642 3300005200 Unclassified 25494
10 Ga0123357_10000076 3300009784 Bacteria 78275
11 Ga0123357_10000114 3300009784 Bacteria 68176
12 Ga0466711_439053 3300042615 Bacteria 2614
13 Ga0466718_136609 3300042617 Bacteria 3217
14 Ga0466728_480695 3300042620 Bacteria 2397
15 Ga0466729_178702 3300042621 Bacteria 10154
16 Ga0466734_052706 3300042623 Bacteria 3087
17 Ga0466703_248905 3300042636 Bacteria 17853
18 Ga0466703_423520 3300042636 Bacteria 28320
19 Ga0466706_122685 3300042599 Bacteria 2761
20 Ga0466706_255861 3300042599 Bacteria 8801
21 Ga0466707_363247 3300042601 Bacteria 7909
22 Ga0466717_149943 3300042604 Bacteria 1835
23 Ga0466716_173207 3300042605 Bacteria 4546
24 Ga0562377_2801 3300056842 Bacteria 11477
25 Ga0562376_0027 3300056857 Bacteria 397453
26 Ga0123357_10004619 3300009784 Unclassified 16244
27 Ga0123357_10007961 3300009784 Bacteria 13184
28 Ga0123356_10001701 3300010049 Bacteria 24084
29 Ga0123353_10000223 3300010167 Bacteria 72131
30 Ga0160432_100880 3300012818 Bacteria 13082
31 Ga0160448_103406 3300012854 Bacteria 4663
32 Ga0466690_030886 3300042590 Bacteria 6299
33 Ga0466691_027331 3300042593 Bacteria 9493
34 JGI24698J34947_10032448 3300002449 Bacteria 2742
35 JGI24702J35022_10025177 3300002462 Bacteria 3213
36 Ga0103268_1000164 3300007192 Bacteria 21882
37 Ga0466711_314880 3300042615 Bacteria 8104
38 Ga0466715_308682 3300042616 Bacteria 3387
39 Ga0466718_035250 3300042617 Bacteria 5178
40 Ga0466704_011860 3300042643 Bacteria 5047
41 Ga0466704_415887 3300042643 Bacteria 115022
42 Ga0466708_195163 3300042652 Bacteria 7424
43 Ga0466727_318492 3300042655 Bacteria 10842
44 Ga0466706_276933 3300042599 Bacteria 9773
45 Ga0466733_189122 3300042659 Bacteria 1898
46 Ga0123357_10028724 3300009784 Unclassified 7535
47 Ga0123356_10000188 3300010049 Bacteria 71322
48 Ga0123354_10040056 3300010882 Bacteria 7255
49 Ga0123354_10048603 3300010882 Unclassified 6448
50 Ga0160447_103517 3300012849 Bacteria 4985
51 Ga0160436_1001137 3300012861 Unclassified 7673
52 Ga0466691_121716 3300042593 Bacteria 10232
53 JGI24699J35502_11133053 3300002509 Unclassified 8467
54 Ga0123357_10001080 3300009784 Bacteria 28141
55 Ga0466705_414663 3300042612 Bacteria 7732
56 Ga0466726_232342 3300042619 Bacteria 3322
57 Ga0466706_093255 3300042599 Bacteria 7264
58 Ga0466713_033429 3300042602 Bacteria 27281
59 Ga0123355_10227490 3300009826 Unclassified 2670
60 Ga0123353_10000096 3300010167 Bacteria 101248
61 Ga0123353_10001161 3300010167 Bacteria 32120
62 Ga0123353_10001324 3300010167 Bacteria 30368
63 Ga0123354_10008288 3300010882 Bacteria 15785
64 Ga0123354_10024943 3300010882 Bacteria 9428
65 Ga0160471_100012 3300012812 Bacteria 433895
66 Ga0072940_1033211 3300005200 Bacteria 14113
67 Ga0466705_480185 3300042612 Bacteria 3388
68 Ga0466710_112767 3300042613 Bacteria 5962
69 Ga0466715_110461 3300042616 Bacteria 13418
70 Ga0466715_160448 3300042616 Bacteria 2214
71 Ga0466723_007010 3300042618 Bacteria 12985
72 Ga0466723_138051 3300042618 Bacteria 18367
73 Ga0466705_122858 3300042612 Unclassified 3410
74 Ga0466729_260758 3300042621 Bacteria 2754
75 Ga0466729_313346 3300042621 Bacteria 10696
76 Ga0466703_103691 3300042636 Bacteria 71973
77 Ga0466704_034783 3300042643 Bacteria 163660
78 Ga0466704_318234 3300042643 Bacteria 18704
79 Ga0466707_219605 3300042601 Bacteria 4679
80 Ga0466713_054427 3300042602 Bacteria 2706
81 Ga0562374_0002 3300057007 Bacteria 3515001
82 Ga0123355_10001198 3300009826 Bacteria 36081
83 Ga0123353_10002042 3300010167 Bacteria 24925
84 Ga0123353_10104054 3300010167 Bacteria 4575
85 Ga0123354_10003541 3300010882 Unclassified 21620
86 Ga0123354_10064681 3300010882 Unclassified 5361
87 Ga0466657_340973 3300042582 Bacteria 12036
88 Ga0466696_191517 3300042596 Bacteria 3321
89 HBC_ctgsDRAFT_1010445 3300000333 Bacteria 2211
90 Ga0072940_1021602 3300005200 Bacteria 9253
91 Ga0466715_246198 3300042616 Bacteria 81329
92 Ga0466723_228478 3300042618 Bacteria 2248
93 Ga0466726_201919 3300042619 Bacteria 13193
94 Ga0466703_024420 3300042636 Bacteria 26777
95 Ga0466703_203351 3300042636 Bacteria 31013
96 Ga0466703_258346 3300042636 Bacteria 13463
97 Ga0466704_174793 3300042643 Bacteria 3044
98 Ga0466707_269543 3300042601 Bacteria 52716
99 Ga0466714_100360 3300042603 Bacteria 4038
100 Ga0466719_107074 3300042606 Bacteria 8469
101 Ga0466719_240432 3300042606 Bacteria 56451
102 Ga0123357_10011546 3300009784 Unclassified 11337
103 Ga0123356_10214453 3300010049 Bacteria 1977
104 Ga0123353_10008165 3300010167 Bacteria 14261
105 Ga0466696_439932 3300042596 Bacteria 16870
106 JGI24705J35276_12227073 3300002504 Bacteria 2943
107 Ga0072941_1056215 3300005201 Bacteria 21887
108 Ga0103264_1000026 3300007188 Bacteria 92644
109 Ga0123357_10000690 3300009784 Bacteria 33822
110 Ga0466711_315451 3300042615 Bacteria 16168
111 Ga0466715_523497 3300042616 Bacteria 15673
112 Ga0466718_022770 3300042617 Bacteria 9254
113 Ga0466705_090425 3300042612 Bacteria 6962
114 Ga0466729_251501 3300042621 Bacteria 2167
115 Ga0466730_027068 3300042625 Bacteria 2012
116 Ga0466703_281545 3300042636 Bacteria 3682
117 Ga0466704_133798 3300042643 Bacteria 12935
118 Ga0466706_231257 3300042599 Bacteria 218825
119 Ga0466700_285033 3300042600 Bacteria 2054
120 Ga0466707_043206 3300042601 Bacteria 70893
121 Ga0466707_258806 3300042601 Unclassified 4336
122 Ga0466713_011559 3300042602 Bacteria 56950
123 Ga0466713_033508 3300042602 Bacteria 20267
124 Ga0466713_075576 3300042602 Unclassified 7752
125 Ga0466733_187582 3300042659 Bacteria 87354
126 Ga0123357_10051893 3300009784 Bacteria 5541
127 Ga0123356_10041989 3300010049 Bacteria 4262
128 Ga0123353_10000822 3300010167 Bacteria 37789
129 Ga0160434_100040 3300012850 Bacteria 105246
130 Ga0466692_103469 3300042591 Bacteria 7232
131 Ga0466696_201266 3300042596 Bacteria 11294
132 Ga0103267_1000229 3300007190 Bacteria 22087
133 Ga0466715_173128 3300042616 Bacteria 4830
134 Ga0466723_068624 3300042618 Bacteria 10490
135 Ga0466728_044204 3300042620 Bacteria 6341
136 Ga0466729_248889 3300042621 Bacteria 4347
137 Ga0466730_036564 3300042625 Bacteria 22759
138 Ga0466703_389427 3300042636 Bacteria 3486
139 Ga0466703_429007 3300042636 Bacteria 26393
140 Ga0466727_004073 3300042655 Bacteria 8979
141 Ga0466700_027594 3300042600 Bacteria 3554
142 Ga0466713_031712 3300042602 Bacteria 12102
143 Ga0466716_089387 3300042605 Bacteria 13522
144 Ga0466733_208395 3300042659 Bacteria 8279
145 Ga0123357_10012376 3300009784 Unclassified 11003
146 Ga0123356_10026884 3300010049 Bacteria 5396
147 Ga0123353_10000229 3300010167 Bacteria 70834
148 Ga0123353_10097843 3300010167 Bacteria 4729
149 Ga0123354_10052599 3300010882 Bacteria 6134
150 Ga0123354_10086000 3300010882 Unclassified 4399
151 Ga0160436_1001706 3300012861 Bacteria 5877
152 Ga0466690_086514 3300042590 Unclassified 17975
153 Ga0466693_056620 3300042592 Bacteria 145249
154 JGI24699J35502_11130196 3300002509 Bacteria 4999
155 JGI24699J35502_11134065 3300002509 Bacteria 27982
156 JGI24699J35502_11134109 3300002509 Bacteria 31659
157 Ga0102735_1000005 3300007080 Bacteria 94864
158 Ga0105524_100943 3300007733 Bacteria 27578
159 Ga0123357_10000502 3300009784 Bacteria 38014
160 Ga0466715_353650 3300042616 Bacteria 17297
161 Ga0466723_014823 3300042618 Bacteria 5899
162 Ga0466723_081350 3300042618 Bacteria 6309
163 Ga0466723_085612 3300042618 Bacteria 17825
164 Ga0466723_196276 3300042618 Bacteria 9132
165 Ga0466728_116900 3300042620 Bacteria 5416
166 Ga0466708_010663 3300042652 Bacteria 26594
167 Ga0466727_131520 3300042655 Bacteria 26381
168 Ga0466707_377241 3300042601 Bacteria 85191
169 Ga0466713_113029 3300042602 Bacteria 128375
170 Ga0466716_017139 3300042605 Bacteria 14533
171 Ga0466721_023958 3300042608 Bacteria 1910

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00005 ABC_tran ABC transporter 21 190 0.96
PF12848 ABC_tran_Xtn ABC transporter 229 305 0.8

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.