Protein Family IF01223
Metagenome
Isolate
110
Members
38
Samples
106
Scaffolds
283.48
Avg Length
Representative Sequence
- ID
- 3300005083|Ga0068305_10922660|Ga0068305_109226602
- Length
- 324 aa
- Sequence
- MGSLRGLAACCAGRSFAEKAAENPEKRAAGSLAGDYRLGLYEKAMPPGLSFEEKLEAAKGGGFDFLELSIDETDEKLARLDWTGAEIRALLRAVQDRDMPVSSICLSGHRRFPLGDPDPETRARGLEIMEKAILLAGRLGVRLIQIAGYDVYYKPGDETTRSLFAENLARSVEMAARSSVLLAFETMETPFLNTVEKAMVWVRKFSSPYLAVYPDLGNITCAAGGDRRAVAADLEKGRGHLAALHLKETRPGVFREVPYGEGHVDFGEGIKTAWALGVRMFNAEFWWTPAVGEGWRALLEKNAAFLRGKIGEDVTVNFNHRDP*
Sample Types
Isolate
3.6%
Metagenome
96.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
34.2%
Termitidae
26.3%
Unclassified
18.4%
Rhinotermitidae
10.5%
Termopsidae
7.9%
Hodotermitidae
2.6%
Taxonomy
Archaea
1
Bacteria
106
Eukaryota
0
Viruses
0
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125652 | Treponema sp. Cu122P5bin1 | Isolate | Unclassified |
| 2 | 2781125685 | Treponema sp. Lab288P1bin13 | Isolate | Unclassified |
| 3 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 7 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 8 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 9 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 10 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 11 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 12 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 13 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 14 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 15 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 16 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 17 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 18 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 19 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 20 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 21 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 22 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 23 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 24 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 25 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 26 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 27 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 28 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 29 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 30 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 31 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 32 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 33 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 34 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 35 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 36 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 37 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 38 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_073172 | 3300042612 | Bacteria | 1446 |
| 2 | Ga0068305_10922660 | 3300005083 | Bacteria | 2602 |
| 3 | Ga0466706_148571 | 3300042599 | Bacteria | 2656 |
| 4 | Ga0466707_406641 | 3300042601 | Bacteria | 4462 |
| 5 | Ga0466719_058933 | 3300042606 | Bacteria | 4077 |
| 6 | Ga0123357_10104557 | 3300009784 | Bacteria | 3635 |
| 7 | Ga0466692_035618 | 3300042591 | Bacteria | 7133 |
| 8 | Ga0466691_207462 | 3300042593 | Bacteria | 8152 |
| 9 | Ga0466723_010074 | 3300042618 | Bacteria | 7246 |
| 10 | Ga0466726_014565 | 3300042619 | Bacteria | 1497 |
| 11 | Ga0466703_008219 | 3300042636 | Bacteria | 15461 |
| 12 | Ga0466703_017911 | 3300042636 | Bacteria | 4811 |
| 13 | Ga0466703_256484 | 3300042636 | Bacteria | 12078 |
| 14 | Ga0466704_335796 | 3300042643 | Bacteria | 67702 |
| 15 | Ga0466707_406554 | 3300042601 | Bacteria | 2414 |
| 16 | Ga0466713_043845 | 3300042602 | Bacteria | 115614 |
| 17 | Ga0466716_299204 | 3300042605 | Unclassified | 1935 |
| 18 | Ga0466719_348275 | 3300042606 | Bacteria | 1635 |
| 19 | Ga0123353_10257945 | 3300010167 | Bacteria | 2695 |
| 20 | Ga0466690_183201 | 3300042590 | Bacteria | 2312 |
| 21 | Ga0466690_186779 | 3300042590 | Bacteria | 6619 |
| 22 | Ga0466691_010181 | 3300042593 | Bacteria | 15310 |
| 23 | Ga0466705_394256 | 3300042612 | Bacteria | 20674 |
| 24 | Ga0466705_523754 | 3300042612 | Bacteria | 6694 |
| 25 | Ga0466723_172557 | 3300042618 | Bacteria | 4243 |
| 26 | Ga0466728_112463 | 3300042620 | Bacteria | 3816 |
| 27 | Ga0466703_070280 | 3300042636 | Bacteria | 7199 |
| 28 | Ga0466703_099422 | 3300042636 | Bacteria | 9978 |
| 29 | Ga0466705_016553 | 3300042612 | Bacteria | 1503 |
| 30 | Ga0466705_176870 | 3300042612 | Bacteria | 2966 |
| 31 | Ga0466707_345199 | 3300042601 | Bacteria | 1156 |
| 32 | Ga0466719_167098 | 3300042606 | Bacteria | 38069 |
| 33 | Ga0466719_356796 | 3300042606 | Bacteria | 3826 |
| 34 | Ga0123353_10269028 | 3300010167 | Bacteria | 2627 |
| 35 | Ga0123353_10346445 | 3300010167 | Bacteria | 2241 |
| 36 | Ga0415639_202855 | 3300038395 | Bacteria | 1972 |
| 37 | Ga0456237_0000119 | 3300041968 | Bacteria | 11641 |
| 38 | Ga0466690_218839 | 3300042590 | Bacteria | 9807 |
| 39 | Ga0466691_058953 | 3300042593 | Bacteria | 19492 |
| 40 | Ga0466696_264993 | 3300042596 | Bacteria | 4704 |
| 41 | Ga0466715_356871 | 3300042616 | Bacteria | 26175 |
| 42 | Ga0466735_039233 | 3300042624 | Bacteria | 12442 |
| 43 | Ga0466703_024326 | 3300042636 | Bacteria | 2444 |
| 44 | Ga0466703_227062 | 3300042636 | Bacteria | 13903 |
| 45 | Ga0466704_387013 | 3300042643 | Bacteria | 3266 |
| 46 | Ga0466709_115669 | 3300042648 | Bacteria | 217304 |
| 47 | Ga0466705_023303 | 3300042612 | Bacteria | 2186 |
| 48 | Ga0466706_138260 | 3300042599 | Bacteria | 1533 |
| 49 | Ga0466706_170397 | 3300042599 | Bacteria | 6967 |
| 50 | Ga0466719_094348 | 3300042606 | Bacteria | 14801 |
| 51 | Ga0123353_10090367 | 3300010167 | Bacteria | 4931 |
| 52 | Ga0466690_025761 | 3300042590 | Bacteria | 4292 |
| 53 | Ga0466699_019687 | 3300042597 | Bacteria | 1099 |
| 54 | Ga0466711_115224 | 3300042615 | Bacteria | 1197 |
| 55 | Ga0466715_322054 | 3300042616 | Bacteria | 11900 |
| 56 | Ga0466715_326990 | 3300042616 | Bacteria | 2213 |
| 57 | Ga0466723_018082 | 3300042618 | Bacteria | 4680 |
| 58 | Ga0466723_064185 | 3300042618 | Bacteria | 19759 |
| 59 | Ga0466723_211951 | 3300042618 | Bacteria | 2327 |
| 60 | Ga0466704_027870 | 3300042643 | Bacteria | 7376 |
| 61 | Ga0466709_373763 | 3300042648 | Bacteria | 29333 |
| 62 | Ga0466727_046302 | 3300042655 | Bacteria | 1850 |
| 63 | Ga0466705_086225 | 3300042612 | Bacteria | 10012 |
| 64 | Ga0466716_312097 | 3300042605 | Bacteria | 4570 |
| 65 | Ga0466716_468865 | 3300042605 | Bacteria | 2727 |
| 66 | Ga0466722_150664 | 3300042609 | Bacteria | 25191 |
| 67 | Ga0123353_10514717 | 3300010167 | Bacteria | 1739 |
| 68 | Ga0466692_092846 | 3300042591 | Bacteria | 1250 |
| 69 | Ga0466694_037428 | 3300042594 | Bacteria | 17187 |
| 70 | Ga0466715_516662 | 3300042616 | Bacteria | 30690 |
| 71 | Ga0466729_229187 | 3300042621 | Bacteria | 2145 |
| 72 | Ga0466709_093189 | 3300042648 | Bacteria | 3037 |
| 73 | Ga0466705_317216 | 3300042612 | Bacteria | 18450 |
| 74 | Ga0123357_10001103 | 3300009784 | Bacteria | 27990 |
| 75 | Ga0466707_078617 | 3300042601 | Bacteria | 1998 |
| 76 | Ga0466719_133300 | 3300042606 | Bacteria | 4755 |
| 77 | Ga0123354_10169877 | 3300010882 | Unclassified | 2543 |
| 78 | Ga0466690_020743 | 3300042590 | Bacteria | 4756 |
| 79 | Ga0466690_194791 | 3300042590 | Bacteria | 3766 |
| 80 | Ga0466692_152595 | 3300042591 | Bacteria | 2190 |
| 81 | Ga0466691_023778 | 3300042593 | Bacteria | 29657 |
| 82 | Ga0466691_183986 | 3300042593 | Bacteria | 7931 |
| 83 | Ga0466711_118855 | 3300042615 | Bacteria | 11396 |
| 84 | Ga0466715_015275 | 3300042616 | Bacteria | 5861 |
| 85 | Ga0466718_136488 | 3300042617 | Bacteria | 3462 |
| 86 | Ga0466723_212087 | 3300042618 | Bacteria | 1482 |
| 87 | Ga0466723_304266 | 3300042618 | Bacteria | 5211 |
| 88 | Ga0466726_275557 | 3300042619 | Bacteria | 1119 |
| 89 | Ga0466704_055884 | 3300042643 | Bacteria | 73215 |
| 90 | Ga0466704_275455 | 3300042643 | Bacteria | 13689 |
| 91 | Ga0466716_283114 | 3300042605 | Bacteria | 7641 |
| 92 | Ga0466694_169990 | 3300042594 | Bacteria | 1325 |
| 93 | Ga0466723_277846 | 3300042618 | Bacteria | 8582 |
| 94 | Ga0466703_375575 | 3300042636 | Bacteria | 12370 |
| 95 | Ga0466704_341431 | 3300042643 | Bacteria | 1497 |
| 96 | Ga0466704_584315 | 3300042643 | Bacteria | 1311 |
| 97 | Ga0466727_300364 | 3300042655 | Bacteria | 1308 |
| 98 | Ga0466705_067689 | 3300042612 | Unclassified | 1035 |
| 99 | Ga0072940_1223851 | 3300005200 | Bacteria | 4249 |
| 100 | Ga0466700_495127 | 3300042600 | Archaea | 1460 |
| 101 | Ga0466717_053705 | 3300042604 | Bacteria | 1382 |
| 102 | Ga0466690_331614 | 3300042590 | Bacteria | 6721 |
| 103 | Ga0466715_308218 | 3300042616 | Bacteria | 1617 |
| 104 | Ga0466723_080860 | 3300042618 | Bacteria | 3801 |
| 105 | Ga0466703_049531 | 3300042636 | Bacteria | 42822 |
| 106 | Ga0466727_080136 | 3300042655 | Bacteria | 1897 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01261 | AP_endonuc_2 | Xylose isomerase-like TIM barrel | 56 | 305 | 0.88 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.