Protein Family IF01219

Metagenome Isolate
134 Members
68 Samples
112 Scaffolds
87.76 Avg Length

🧬 Representative Sequence

ID
3300005083|Ga0068305_10574882|Ga0068305_105748823
Length
102 aa
Sequence
VFKSWDDDAWADYLYWQTQDKKTLKRIHALIKDIERSPYEGIGKPEPSTEPRSGEGSPLAPLKYDLSGYWSRRIDESNRIVYRIKEDRIEIIQCGAHYRDS*

📊 Sample Types

Isolate 16.4%
Metagenome 83.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 28.8%
Unclassified 24.2%
Kalotermitidae 15.2%
Drosophilidae 7.6%
Formicidae 6.1%
Rhinotermitidae 3.0%
Palinuridae 3.0%
Hodotermitidae 1.5%
Apidae 1.5%
Culicidae 1.5%
Majidae 1.5%
Sarcophagidae 1.5%
Termopsidae 1.5%
Armadillidiidae 1.5%
Kiwaidae 1.5%

🌳 Taxonomy

Archaea 0
Bacteria 118
Eukaryota 0
Viruses 0
Unclassified 16

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2565956518 Vibrio pacinii DSM 19139 Isolate Unclassified
2 2600255074 Vibrio proteolyticus NBRC 13287 Isolate Unclassified
3 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
4 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
5 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
6 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
7 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
8 3300005311 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 1 gut Metagenome Drosophilidae
9 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
10 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
11 2844251356 Photobacterium leiognathi mandapamensis ajapo.3.1 Isolate Unclassified
12 2880115952 Vibrio parahaemolyticus PB1937 Isolate Unclassified
13 2912636047 Vibrio crassostreae 9CS106 Isolate Unclassified
14 2654587515 Vibrio owensii CAIM 1854 Isolate Palinuridae
15 2820333861 Unclassified Firmicutes Nt197P3bin72 Isolate Unclassified
16 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
17 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
18 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
19 3300007153 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut Metagenome Drosophilidae
20 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
21 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
22 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
23 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
24 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
25 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
26 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
27 2860776474 Vibrio parahaemolyticus R14 Isolate Unclassified
28 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
29 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
30 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
31 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
32 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
33 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
34 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
35 2840797934 Gilliamella apicola Choc5-1 Isolate Apidae
36 2877647439 Vibrio parahaemolyticus R13 Isolate Unclassified
37 8060845732 Vibrio vulnificus Vv006 Isolate
38 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
39 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
40 3300005308 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 1 gut Metagenome Drosophilidae
41 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
42 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
43 2524614573 Marinospirillum minutulum DSM 6287 Isolate Unclassified
44 2667527830 Vibrio parahaemolyticus ISF-29-3 Isolate Unclassified
45 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
46 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
47 3300005299 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 1 gut Metagenome Drosophilidae
48 2873884416 Photobacterium sanguinicancri Mj110 CAIM 1827 Isolate Majidae
49 2791355471 Vibrio bivalvicida 605 Isolate Unclassified
50 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
51 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
52 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
53 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
54 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
55 2868883784 Photobacterium leiognathi mandapamensis AJ-1a Isolate Unclassified
56 2571042554 Vibrio owensii CAIM 1854 Isolate Palinuridae
57 3300007150 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut Metagenome Drosophilidae
58 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
59 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
60 2513237114 Ignatzschineria larvae DSM 13226 Isolate Sarcophagidae
61 2663763317 Vibrio parahaemolyticus ISF-94-1 Isolate Unclassified
62 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
63 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
64 8051551332 Vibrio vulnificus Vv003 Isolate
65 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
66 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
67 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
68 3300013007 Symbiotic microbial communities associated with the hydrothermal yeti crab kiwa sp. n. from the East Pacific Rise in the East Pacific Ocean - crab 1, guts Metagenome Kiwaidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466707_246917 3300042601 Bacteria 6316
2 Ga0466707_350752 3300042601 Bacteria 2083
3 Ga0466719_186174 3300042606 Bacteria 12019
4 JGI24702J35022_10760838 3300002462 Bacteria 603
5 Ga0123356_10210386 3300010049 Bacteria 1993
6 Ga0123356_13268448 3300010049 Bacteria 564
7 Ga0123354_11060784 3300010882 Bacteria 517
8 Ga0466733_051970 3300042659 Unclassified 5418
9 Ga0415639_043379 3300038395 Bacteria 1633
10 Ga0415639_047460 3300038395 Bacteria 1416
11 Ga0466690_137489 3300042590 Bacteria 1285
12 Ga0466690_381448 3300042590 Bacteria 1252
13 Ga0466696_402374 3300042596 Bacteria 1303
14 Ga0466706_080721 3300042599 Bacteria 40521
15 Ga0466713_083145 3300042602 Bacteria 93181
16 Ga0466713_145930 3300042602 Bacteria 2674
17 Ga0466721_076472 3300042608 Bacteria 101745
18 Ga0466711_366082 3300042615 Bacteria 1583
19 Ga0466715_012610 3300042616 Bacteria 1877
20 Ga0466723_068258 3300042618 Bacteria 1253
21 Ga0466729_136380 3300042621 Bacteria 1540
22 Ga0102740_1001920 3300007140 Bacteria 4992
23 Ga0123355_10003495 3300009826 Bacteria 22540
24 Ga0466734_010173 3300042623 Bacteria 1462
25 Ga0466734_018073 3300042623 Bacteria 1396
26 Ga0466707_314024 3300042601 Bacteria 1310
27 Ga0466729_144386 3300042621 Bacteria 1460
28 JGI24702J35022_10093826 3300002462 Bacteria 1636
29 JGI24699J35502_10965471 3300002509 Unclassified 1218
30 Ga0074310_1125412 3300005308 Unclassified 4916
31 Ga0074300_1000800 3300005311 Unclassified 6853
32 Ga0123357_10741714 3300009784 Bacteria 686
33 Ga0123355_11367753 3300009826 Bacteria 703
34 Ga0123353_10772627 3300010167 Bacteria 1332
35 Ga0123353_11427220 3300010167 Bacteria 888
36 Ga0123353_12006094 3300010167 Bacteria 709
37 Ga0466704_253498 3300042643 Bacteria 10000
38 Ga0160434_151810 3300012850 Unclassified 508
39 Ga0157631_138067 3300013007 Bacteria 1755
40 Ga0466693_324969 3300042592 Bacteria 2840
41 Ga0466706_192077 3300042599 Bacteria 3948
42 Ga0466721_158520 3300042608 Bacteria 1696
43 Ga0466722_149087 3300042609 Bacteria 2173
44 Ga0123357_10436927 3300009784 Bacteria 1150
45 Ga0123357_10449153 3300009784 Bacteria 1120
46 Ga0123355_10680100 3300009826 Bacteria 1189
47 Ga0123356_10558532 3300010049 Bacteria 1306
48 Ga0123353_10773913 3300010167 Bacteria 1331
49 Ga0123353_10959665 3300010167 Bacteria 1155
50 Ga0123353_13423240 3300010167 Bacteria 503
51 Ga0466735_108974 3300042624 Bacteria 7976
52 Ga0466705_274308 3300042612 Unclassified 4953
53 Ga0466733_186651 3300042659 Bacteria 3441
54 Ga0466733_197563 3300042659 Bacteria 29933
55 Ga0160443_100263 3300012848 Bacteria 53051
56 Ga0466690_405690 3300042590 Bacteria 1914
57 Ga0466694_147287 3300042594 Bacteria 1546
58 Ga0466707_286308 3300042601 Bacteria 2293
59 Ga0466721_224582 3300042608 Bacteria 1190
60 Ga0466705_521751 3300042612 Bacteria 1762
61 Ga0466711_412867 3300042615 Bacteria 8148
62 Ga0466715_307480 3300042616 Unclassified 1330
63 Ga0466715_320779 3300042616 Bacteria 1248
64 JGI24698J34947_10002586 3300002449 Bacteria 9776
65 Ga0104019_1036573 3300007150 Bacteria 4394
66 Ga0103268_1000333 3300007192 Bacteria 15268
67 Ga0466735_224371 3300042624 Bacteria 1234
68 Ga0466703_043544 3300042636 Bacteria 2084
69 Ga0466705_308516 3300042612 Bacteria 3514
70 Ga0466733_213439 3300042659 Bacteria 1113
71 Ga0415639_010754 3300038395 Bacteria 7984
72 Ga0466693_385465 3300042592 Bacteria 1364
73 Ga0466707_152269 3300042601 Bacteria 11284
74 Ga0466714_041696 3300042603 Bacteria 1756
75 Ga0466719_153825 3300042606 Bacteria 2581
76 Ga0466711_126724 3300042615 Bacteria 3545
77 JGI24695J34938_10502642 3300002450 Bacteria 554
78 JGI24702J35022_10118163 3300002462 Unclassified 1463
79 Ga0068305_10574882 3300005083 Bacteria 2960
80 Ga0123353_10690003 3300010167 Bacteria 1436
81 Ga0123353_11270202 3300010167 Unclassified 959
82 Ga0466735_164072 3300042624 Unclassified 1022
83 Ga0466735_231551 3300042624 Bacteria 2896
84 Ga0466704_195134 3300042643 Bacteria 5303
85 Ga0466719_405487 3300042606 Bacteria 21674
86 Ga0466721_018765 3300042608 Bacteria 2764
87 Ga0466711_017001 3300042615 Bacteria 4073
88 JGI24702J35022_10205538 3300002462 Unclassified 1129
89 JGI24696J40584_12446880 3300002834 Unclassified 574
90 Ga0068305_10126917 3300005083 Bacteria 2625
91 Ga0074146_1079225 3300005299 Bacteria 757
92 Ga0123355_11593023 3300009826 Bacteria 630
93 Ga0123356_11516760 3300010049 Bacteria 827
94 Ga0123356_13238676 3300010049 Unclassified 567
95 Ga0466734_087895 3300042623 Bacteria 2290
96 Ga0466697_127243 3300042611 Bacteria 1014
97 Ga0466705_262640 3300042612 Bacteria 1397
98 Ga0466733_044078 3300042659 Bacteria 1557
99 Ga0466690_209234 3300042590 Bacteria 2685
100 Ga0466714_143275 3300042603 Unclassified 1068
101 JGI24695J34938_10221796 3300002450 Bacteria 794
102 CVPL010W_10068405 3300002931 Bacteria 669
103 CVPL005W_1000116 3300002934 Bacteria 36019
104 Ga0104050_1003069 3300007153 Unclassified 16390
105 Ga0123357_10016009 3300009784 Bacteria 9852
106 Ga0123357_10221078 3300009784 Bacteria 2101
107 Ga0123355_11303702 3300009826 Bacteria 728
108 Ga0123356_10822562 3300010049 Bacteria 1100
109 Ga0123354_10157346 3300010882 Bacteria 2719
110 Ga0466731_349637 3300042622 Bacteria 1627
111 Ga0466735_220585 3300042624 Unclassified 1795
112 Ga0466709_407586 3300042648 Bacteria 1742

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF06769 YoeB_toxin YoeB-like toxin of bacterial type II toxin-antitoxin system 50 98 0.94

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.