Protein Family IF01193
Metagenome
Isolate
111
Members
49
Samples
105
Scaffolds
428.5
Avg Length
Representative Sequence
- ID
- 3300005083|Ga0068305_10066271|Ga0068305_100662712
- Length
- 480 aa
- Sequence
- LIIFHETPRKYRQNISHDTLTDKNILFIFASFLALIFKKRYSMFLTKRFYIAGLIIITFITGGYFYTPLFIAGKILMATLLIATVIEIILLWHKRKPADAERYCAPRFSNGDDNDVRLVIDNFYPFSVGIDIIDEIPVVFQRRDILFKIRIKARSREVIHYRLRPVKRGEYGFGHVLLYIGTRIGLVVRRCKCSDPVNIAVYPSYIMLRKYEIMAIHNNLTELGIKKIRRVGHNTEFEYIKEYIKGDDYRTINWKASARRHFPMVNVYQDERSQQIYNIIDKGRVMQNAFRDMTLLDYSINASLVLSFVAIRKDDKVGLATFAEDFETFIPASKQNTQMQIILDSLYRQQTTFGESDYSALYVHINKHVSKRSLLIIYTNFDTIIGMERQIEYLRQLAHKHVVLVVFFEDTEMKAFASERPKDIEGYYQRVITDKFIFEKHHVVASLRQHGVYSLLTEPDKLSVNVINKYLEMKARGMI*
Sample Types
Isolate
5.4%
Metagenome
94.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
29.2%
Termitidae
27.1%
Unclassified
10.4%
Rhinotermitidae
8.3%
Termopsidae
8.3%
Blattidae
6.2%
Passalidae
4.2%
Formicidae
4.2%
Hodotermitidae
2.1%
Taxonomy
Archaea
0
Bacteria
104
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 2 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 3 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 4 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 5 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 6 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 7 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 8 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 9 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 10 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 11 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 12 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 13 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 14 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 15 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 16 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 17 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 18 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 19 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 20 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 21 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 22 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 23 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 24 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 25 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 26 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 27 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 28 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 29 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 30 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 31 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 32 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 33 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 34 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 35 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 36 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 37 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 38 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 39 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 40 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 41 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 42 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 43 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 44 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 45 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 46 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 47 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 48 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 49 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_197308 | 3300042612 | Bacteria | 9714 |
| 2 | Ga0466705_273899 | 3300042612 | Bacteria | 9196 |
| 3 | Ga0466700_375735 | 3300042600 | Bacteria | 5421 |
| 4 | Ga0466713_024728 | 3300042602 | Bacteria | 13522 |
| 5 | Ga0466716_163501 | 3300042605 | Bacteria | 10981 |
| 6 | Ga0466716_195684 | 3300042605 | Bacteria | 24114 |
| 7 | Ga0072941_1368255 | 3300005201 | Bacteria | 1538 |
| 8 | Ga0466703_110828 | 3300042636 | Bacteria | 8960 |
| 9 | Ga0466727_059700 | 3300042655 | Bacteria | 6876 |
| 10 | Ga0466723_018283 | 3300042618 | Bacteria | 2894 |
| 11 | Ga0466696_164749 | 3300042596 | Bacteria | 7717 |
| 12 | Ga0466713_082426 | 3300042602 | Bacteria | 104514 |
| 13 | Ga0068302_10573161 | 3300005071 | Bacteria | 1631 |
| 14 | Ga0466727_275368 | 3300042655 | Unclassified | 1386 |
| 15 | Ga0466711_322902 | 3300042615 | Bacteria | 9907 |
| 16 | Ga0466723_099349 | 3300042618 | Bacteria | 21770 |
| 17 | Ga0466729_061490 | 3300042621 | Bacteria | 22153 |
| 18 | Ga0466696_321606 | 3300042596 | Bacteria | 2384 |
| 19 | Ga0466713_097258 | 3300042602 | Bacteria | 19247 |
| 20 | Ga0466719_089527 | 3300042606 | Bacteria | 9863 |
| 21 | Ga0466722_176607 | 3300042609 | Bacteria | 9179 |
| 22 | 2227476841 | 2225789004 | Bacteria | 4612 |
| 23 | JGI24696J40584_12952982 | 3300002834 | Bacteria | 2417 |
| 24 | Ga0466709_301340 | 3300042648 | Bacteria | 8518 |
| 25 | Ga0466727_271546 | 3300042655 | Bacteria | 9447 |
| 26 | Ga0466715_099510 | 3300042616 | Bacteria | 28496 |
| 27 | Ga0466715_602386 | 3300042616 | Bacteria | 1622 |
| 28 | Ga0466726_304571 | 3300042619 | Unclassified | 5849 |
| 29 | Ga0466706_141737 | 3300042599 | Bacteria | 29208 |
| 30 | Ga0466707_115548 | 3300042601 | Bacteria | 14973 |
| 31 | Ga0466722_081474 | 3300042609 | Bacteria | 14100 |
| 32 | Ga0123353_10014753 | 3300010167 | Bacteria | 11289 |
| 33 | IMNBL1DRAFT_c0003354 | 3300000062 | Bacteria | 10389 |
| 34 | Ga0466704_019608 | 3300042643 | Bacteria | 8798 |
| 35 | Ga0466704_033241 | 3300042643 | Bacteria | 8272 |
| 36 | Ga0466704_296323 | 3300042643 | Bacteria | 1712 |
| 37 | Ga0466727_115615 | 3300042655 | Bacteria | 4700 |
| 38 | Ga0466690_026886 | 3300042590 | Bacteria | 1640 |
| 39 | Ga0466692_030541 | 3300042591 | Bacteria | 59720 |
| 40 | Ga0466693_272745 | 3300042592 | Unclassified | 2074 |
| 41 | Ga0466699_399958 | 3300042597 | Bacteria | 3013 |
| 42 | Ga0466733_186182 | 3300042659 | Bacteria | 31328 |
| 43 | Ga0466701_052963 | 3300042598 | Bacteria | 41459 |
| 44 | Ga0466707_402710 | 3300042601 | Bacteria | 7034 |
| 45 | Ga0466713_044663 | 3300042602 | Bacteria | 1564 |
| 46 | Ga0466713_089529 | 3300042602 | Bacteria | 6749 |
| 47 | Ga0466698_465345 | 3300042610 | Bacteria | 3457 |
| 48 | IMNBL1DRAFT_c0000424 | 3300000062 | Bacteria | 35477 |
| 49 | Ga0068302_10035489 | 3300005071 | Bacteria | 13496 |
| 50 | Ga0068305_10006305 | 3300005083 | Bacteria | 11379 |
| 51 | Ga0068305_10066271 | 3300005083 | Unclassified | 3951 |
| 52 | Ga0102740_1000045 | 3300007140 | Bacteria | 29250 |
| 53 | Ga0466735_044029 | 3300042624 | Bacteria | 7706 |
| 54 | Ga0466704_299972 | 3300042643 | Bacteria | 18496 |
| 55 | Ga0466727_085727 | 3300042655 | Bacteria | 20650 |
| 56 | Ga0466728_077575 | 3300042620 | Bacteria | 4797 |
| 57 | Ga0466691_183227 | 3300042593 | Bacteria | 8931 |
| 58 | Ga0466705_204950 | 3300042612 | Bacteria | 2768 |
| 59 | Ga0466701_085578 | 3300042598 | Unclassified | 22744 |
| 60 | Ga0466706_013523 | 3300042599 | Bacteria | 77368 |
| 61 | Ga0466719_121657 | 3300042606 | Bacteria | 7847 |
| 62 | Ga0466719_297806 | 3300042606 | Bacteria | 2148 |
| 63 | Ga0123354_10027267 | 3300010882 | Bacteria | 9000 |
| 64 | JGI24702J35022_10017317 | 3300002462 | Bacteria | 3939 |
| 65 | CVPL010W_10000328 | 3300002931 | Bacteria | 47517 |
| 66 | Ga0466704_111942 | 3300042643 | Bacteria | 4565 |
| 67 | Ga0466704_170869 | 3300042643 | Unclassified | 7588 |
| 68 | Ga0466708_169565 | 3300042652 | Bacteria | 34312 |
| 69 | Ga0466708_224946 | 3300042652 | Bacteria | 22929 |
| 70 | Ga0466727_180009 | 3300042655 | Bacteria | 3719 |
| 71 | Ga0466711_039984 | 3300042615 | Bacteria | 3743 |
| 72 | Ga0466711_430251 | 3300042615 | Bacteria | 2917 |
| 73 | Ga0466657_362462 | 3300042582 | Bacteria | 2798 |
| 74 | Ga0466693_085990 | 3300042592 | Bacteria | 1750 |
| 75 | Ga0466696_097315 | 3300042596 | Bacteria | 4179 |
| 76 | Ga0466733_198400 | 3300042659 | Bacteria | 123976 |
| 77 | Ga0466707_101105 | 3300042601 | Bacteria | 1926 |
| 78 | Ga0123354_10106336 | 3300010882 | Bacteria | 3746 |
| 79 | IMNBL1DRAFT_c0005444 | 3300000062 | Bacteria | 7276 |
| 80 | JGI24702J35022_10002367 | 3300002462 | Bacteria | 11530 |
| 81 | Ga0068305_10030758 | 3300005083 | Unclassified | 9387 |
| 82 | Ga0466735_210563 | 3300042624 | Bacteria | 1682 |
| 83 | Ga0466703_281746 | 3300042636 | Bacteria | 12280 |
| 84 | Ga0466709_267740 | 3300042648 | Bacteria | 21898 |
| 85 | Ga0466709_309645 | 3300042648 | Bacteria | 7758 |
| 86 | Ga0466725_016791 | 3300042654 | Bacteria | 21213 |
| 87 | Ga0466725_113264 | 3300042654 | Bacteria | 7484 |
| 88 | Ga0466711_119713 | 3300042615 | Bacteria | 21901 |
| 89 | Ga0466715_385135 | 3300042616 | Bacteria | 14907 |
| 90 | Ga0466723_008432 | 3300042618 | Bacteria | 12035 |
| 91 | Ga0466726_164150 | 3300042619 | Bacteria | 11215 |
| 92 | Ga0466726_294931 | 3300042619 | Bacteria | 3094 |
| 93 | Ga0466657_161428 | 3300042582 | Bacteria | 6885 |
| 94 | Ga0466690_029554 | 3300042590 | Bacteria | 6827 |
| 95 | Ga0466696_012172 | 3300042596 | Bacteria | 4798 |
| 96 | Ga0466705_031864 | 3300042612 | Bacteria | 10340 |
| 97 | Ga0466707_077674 | 3300042601 | Bacteria | 5533 |
| 98 | Ga0466722_136436 | 3300042609 | Bacteria | 9717 |
| 99 | JGI24699J35502_11134231 | 3300002509 | Bacteria | 105586 |
| 100 | Ga0466703_181839 | 3300042636 | Bacteria | 3558 |
| 101 | Ga0466703_205341 | 3300042636 | Bacteria | 5458 |
| 102 | Ga0466704_542163 | 3300042643 | Bacteria | 4962 |
| 103 | Ga0466726_045165 | 3300042619 | Bacteria | 2761 |
| 104 | Ga0466690_115461 | 3300042590 | Bacteria | 7988 |
| 105 | Ga0466696_327901 | 3300042596 | Bacteria | 3928 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042654 | Ga0466725_016791 | Ga0466725_016791_7149_8309 | 386 |
| 2 | 3300042602 | Ga0466713_089529 | Ga0466713_089529_2887_4065 | 392 |
| 3 | iso_pr_bacteria | 2609459943 | 2610743994 | 396 |
| 4 | 3300042602 | Ga0466713_082426 | Ga0466713_082426_5709_6920 | 403 |
| 5 | 3300042618 | Ga0466723_008432 | Ga0466723_008432_4897_6210 | 405 |
| 6 | 3300042643 | Ga0466704_542163 | Ga0466704_542163_220_1533 | 406 |
| 7 | 3300002462 | JGI24702J35022_10017317 | JGI24702J35022_100173173 | 407 |
| 8 | 3300005083 | Ga0068305_10030758 | Ga0068305_100307584 | 407 |
| 9 | 3300042596 | Ga0466696_097315 | Ga0466696_097315_623_1942 | 407 |
| 10 | 3300042596 | Ga0466696_327901 | Ga0466696_327901_1659_2972 | 408 |
| 11 | 3300042590 | Ga0466690_029554 | Ga0466690_029554_4931_6244 | 409 |
| 12 | 3300042598 | Ga0466701_052963 | Ga0466701_052963_18445_19674 | 409 |
| 13 | 3300042598 | Ga0466701_085578 | Ga0466701_085578_12237_13550 | 410 |
| 14 | 3300042601 | Ga0466707_115548 | Ga0466707_115548_13404_14639 | 411 |
| 15 | 3300042648 | Ga0466709_309645 | Ga0466709_309645_2225_3541 | 411 |
| 16 | 3300042659 | Ga0466733_198400 | Ga0466733_198400_64347_65582 | 411 |
| 17 | 3300042590 | Ga0466690_026886 | Ga0466690_026886_209_1522 | 413 |
| 18 | 3300042592 | Ga0466693_272745 | Ga0466693_272745_263_1504 | 413 |
| 19 | 3300000062 | IMNBL1DRAFT_c0005444 | IMNBL1DRAFT_00054442 | 414 |
| 20 | 3300042597 | Ga0466699_399958 | Ga0466699_399958_1674_2987 | 414 |
| 21 | 3300042605 | Ga0466716_195684 | Ga0466716_195684_6742_8055 | 414 |
| 22 | 3300042601 | Ga0466707_402710 | Ga0466707_402710_2248_3495 | 415 |
| 23 | 3300042618 | Ga0466723_018283 | Ga0466723_018283_937_2250 | 415 |
| 24 | 3300042619 | Ga0466726_045165 | Ga0466726_045165_74_1390 | 415 |
| 25 | 3300042612 | Ga0466705_273899 | Ga0466705_273899_7449_8765 | 417 |
| 26 | 3300042648 | Ga0466709_301340 | Ga0466709_301340_6318_7631 | 417 |
| 27 | 3300042596 | Ga0466696_321606 | Ga0466696_321606_416_1729 | 419 |
| 28 | 3300042655 | Ga0466727_275368 | Ga0466727_275368_98_1357 | 419 |
| 29 | 3300042602 | Ga0466713_024728 | Ga0466713_024728_3854_5167 | 421 |
| 30 | 3300042612 | Ga0466705_031864 | Ga0466705_031864_393_1706 | 422 |
| 31 | 3300042616 | Ga0466715_602386 | Ga0466715_602386_199_1512 | 422 |
| 32 | 3300042654 | Ga0466725_113264 | Ga0466725_113264_3435_4748 | 422 |
| 33 | 3300002462 | JGI24702J35022_10002367 | JGI24702J35022_100023679 | 423 |
| 34 | 3300042593 | Ga0466691_183227 | Ga0466691_183227_7321_8634 | 423 |
| 35 | 3300042659 | Ga0466733_186182 | Ga0466733_186182_17880_19193 | 423 |
| 36 | 3300042619 | Ga0466726_304571 | Ga0466726_304571_283_1596 | 424 |
| 37 | 3300042655 | Ga0466727_115615 | Ga0466727_115615_626_1939 | 424 |
| 38 | 3300042655 | Ga0466727_180009 | Ga0466727_180009_630_1943 | 425 |
| 39 | 3300000062 | IMNBL1DRAFT_c0000424 | IMNBL1DRAFT_00004244 | 426 |
| 40 | 3300042612 | Ga0466705_204950 | Ga0466705_204950_1453_2733 | 426 |
| 41 | 3300042652 | Ga0466708_224946 | Ga0466708_224946_15120_16400 | 426 |
| 42 | 3300002509 | JGI24699J35502_11134231 | JGI24699J35502_1113423159 | 427 |
| 43 | 3300042590 | Ga0466690_115461 | Ga0466690_115461_5948_7279 | 427 |
| 44 | 3300042606 | Ga0466719_121657 | Ga0466719_121657_678_1991 | 427 |
| 45 | 3300002834 | JGI24696J40584_12952982 | JGI24696J40584_129529822 | 428 |
| 46 | 3300010882 | Ga0123354_10106336 | Ga0123354_101063363 | 428 |
| 47 | 3300042582 | Ga0466657_362462 | Ga0466657_362462_219_1538 | 428 |
| 48 | 3300042636 | Ga0466703_110828 | Ga0466703_110828_2945_4258 | 429 |
| 49 | 3300042655 | Ga0466727_059700 | Ga0466727_059700_172_1485 | 429 |
| 50 | 3300005071 | Ga0068302_10573161 | Ga0068302_105731611 | 430 |
| 51 | 3300007140 | Ga0102740_1000045 | Ga0102740_10000452 | 433 |
| 52 | 3300042582 | Ga0466657_161428 | Ga0466657_161428_1300_2640 | 433 |
| 53 | 3300042643 | Ga0466704_296323 | Ga0466704_296323_177_1484 | 435 |
| 54 | iso_pr_bacteria | 2922326829 | 2922329025 | 435 |
| 55 | 3300042599 | Ga0466706_013523 | Ga0466706_013523_70037_71347 | 436 |
| 56 | 3300042609 | Ga0466722_136436 | Ga0466722_136436_5841_7151 | 436 |
| 57 | 3300042609 | Ga0466722_176607 | Ga0466722_176607_6719_8029 | 436 |
| 58 | iso_pr_bacteria | 2830041218 | 2830044982 | 436 |
| 59 | iso_pr_bacteria | 3004677695 | 3004679799 | 436 |
| 60 | 2225789004 | 2227476841 | 2227929831 | 437 |
| 61 | 3300042591 | Ga0466692_030541 | Ga0466692_030541_846_2159 | 437 |
| 62 | 3300042592 | Ga0466693_085990 | Ga0466693_085990_216_1529 | 437 |
| 63 | 3300042596 | Ga0466696_164749 | Ga0466696_164749_5137_6450 | 437 |
| 64 | 3300042599 | Ga0466706_141737 | Ga0466706_141737_27127_28440 | 437 |
| 65 | 3300042600 | Ga0466700_375735 | Ga0466700_375735_4061_5374 | 437 |
| 66 | 3300042601 | Ga0466707_077674 | Ga0466707_077674_3084_4397 | 437 |
| 67 | 3300042601 | Ga0466707_101105 | Ga0466707_101105_227_1540 | 437 |
| 68 | 3300042602 | Ga0466713_044663 | Ga0466713_044663_234_1547 | 437 |
| 69 | 3300042602 | Ga0466713_097258 | Ga0466713_097258_9726_11039 | 437 |
| 70 | 3300042605 | Ga0466716_163501 | Ga0466716_163501_7914_9227 | 437 |
| 71 | 3300042606 | Ga0466719_089527 | Ga0466719_089527_629_1942 | 437 |
| 72 | 3300042606 | Ga0466719_297806 | Ga0466719_297806_370_1683 | 437 |
| 73 | 3300042610 | Ga0466698_465345 | Ga0466698_465345_1950_3263 | 437 |
| 74 | 3300042612 | Ga0466705_197308 | Ga0466705_197308_4970_6283 | 437 |
| 75 | 3300042615 | Ga0466711_039984 | Ga0466711_039984_881_2194 | 437 |
| 76 | 3300042615 | Ga0466711_119713 | Ga0466711_119713_4831_6144 | 437 |
| 77 | 3300042615 | Ga0466711_322902 | Ga0466711_322902_7827_9140 | 437 |
| 78 | 3300042616 | Ga0466715_099510 | Ga0466715_099510_8077_9390 | 437 |
| 79 | 3300042618 | Ga0466723_099349 | Ga0466723_099349_11330_12643 | 437 |
| 80 | 3300042619 | Ga0466726_164150 | Ga0466726_164150_5745_7058 | 437 |
| 81 | 3300042619 | Ga0466726_294931 | Ga0466726_294931_1590_2903 | 437 |
| 82 | 3300042620 | Ga0466728_077575 | Ga0466728_077575_588_1901 | 437 |
| 83 | 3300042624 | Ga0466735_044029 | Ga0466735_044029_3662_4975 | 437 |
| 84 | 3300042636 | Ga0466703_181839 | Ga0466703_181839_337_1650 | 437 |
| 85 | 3300042636 | Ga0466703_205341 | Ga0466703_205341_2101_3414 | 437 |
| 86 | 3300042643 | Ga0466704_019608 | Ga0466704_019608_42_1355 | 437 |
| 87 | 3300042643 | Ga0466704_111942 | Ga0466704_111942_2940_4253 | 437 |
| 88 | 3300042643 | Ga0466704_170869 | Ga0466704_170869_5487_6800 | 437 |
| 89 | 3300042643 | Ga0466704_299972 | Ga0466704_299972_149_1462 | 437 |
| 90 | 3300042648 | Ga0466709_267740 | Ga0466709_267740_2724_4037 | 437 |
| 91 | 3300042652 | Ga0466708_169565 | Ga0466708_169565_10498_11811 | 437 |
| 92 | 3300042655 | Ga0466727_271546 | Ga0466727_271546_185_1498 | 437 |
| 93 | iso_pr_bacteria | 2820762746 | 2820765161 | 437 |
| 94 | 3300000062 | IMNBL1DRAFT_c0003354 | IMNBL1DRAFT_000335410 | 438 |
| 95 | 3300005071 | Ga0068302_10035489 | Ga0068302_100354893 | 438 |
| 96 | 3300005083 | Ga0068305_10006305 | Ga0068305_100063053 | 438 |
| 97 | 3300042596 | Ga0466696_012172 | Ga0466696_012172_230_1546 | 438 |
| 98 | 3300042609 | Ga0466722_081474 | Ga0466722_081474_2663_3979 | 438 |
| 99 | 3300042615 | Ga0466711_430251 | Ga0466711_430251_1329_2645 | 438 |
| 100 | 3300042616 | Ga0466715_385135 | Ga0466715_385135_9057_10373 | 438 |
| 101 | 3300042621 | Ga0466729_061490 | Ga0466729_061490_18095_19411 | 438 |
| 102 | 3300042624 | Ga0466735_210563 | Ga0466735_210563_32_1348 | 438 |
| 103 | 3300042636 | Ga0466703_281746 | Ga0466703_281746_9555_10871 | 438 |
| 104 | 3300042643 | Ga0466704_033241 | Ga0466704_033241_5749_7065 | 438 |
| 105 | 3300042655 | Ga0466727_085727 | Ga0466727_085727_19177_20493 | 438 |
| 106 | iso_pr_bacteria | 3004672520 | 3004673508 | 438 |
| 107 | 3300010882 | Ga0123354_10027267 | Ga0123354_100272677 | 439 |
| 108 | 3300010167 | Ga0123353_10014753 | Ga0123353_100147532 | 440 |
| 109 | 3300002931 | CVPL010W_10000328 | CVPL010W_1000032839 | 444 |
| 110 | 3300005201 | Ga0072941_1368255 | Ga0072941_13682551 | 469 |
| 111 | 3300005083 | Ga0068305_10066271 | Ga0068305_100662712 | 480 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01882 | DUF58 | Protein of unknown function DUF58 | 235 | 319 | 0.98 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.71 | 0.76 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.