Protein Family IF01188
Metagenome
Metatranscriptome
Isolate
181
Members
63
Samples
141
Scaffolds
146.73
Avg Length
Representative Sequence
- ID
- 3300005083|Ga0068305_10049264|Ga0068305_100492646
- Length
- 151 aa
- Sequence
- MRSSFVPKISDISHEWFIVDAKDCVLGRLSVEITKLLRGKYKKYYMPNVDAGNYVIIINAEKIKTTGKKNLKKIYRRHSGYPGGVKEIVLRDMLVRKPEFVIRHAIKGMMPKNNLSKIIMKRLFVYAGENYKQVSQKPVMIDLKGVIKHG*
Sample Types
Isolate
22.1%
Metagenome
74.0%
MAG
0.0%
Metatranscriptome
3.9%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
63.5%
Termitidae
30.2%
Kalotermitidae
3.2%
Hodotermitidae
1.6%
Termopsidae
1.6%
Taxonomy
Archaea
1
Bacteria
171
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820285501 | Unclassified Firmicutes Th196P3bin142 | Isolate | Unclassified |
| 2 | 2820306284 | Unclassified Firmicutes Th196P1bin11 | Isolate | Unclassified |
| 3 | 2820435670 | Unclassified Firmicutes Lab288P3bin217 | Isolate | Unclassified |
| 4 | 2820602899 | Unclassified Firmicutes Emb289P1bin51 | Isolate | Unclassified |
| 5 | 2820698910 | Unclassified Firmicutes Co191P1bin64 | Isolate | Unclassified |
| 6 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 7 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 8 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 9 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 10 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 11 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 12 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 13 | 3300021190 | Termite gut microbial communities from nest - French Guiana - 1_3 mRNA 1_3 mRNA SA | Metatranscriptome | Termitidae |
| 14 | 2820385248 | Unclassified Firmicutes Nt197P1bin19 | Isolate | Unclassified |
| 15 | 2820593525 | Unclassified Firmicutes Emb289P1bin7 | Isolate | Unclassified |
| 16 | 2820673891 | Unclassified Firmicutes Co191P3bin18 | Isolate | Unclassified |
| 17 | 2820676843 | Unclassified Firmicutes Co191P3bin17 | Isolate | Unclassified |
| 18 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 19 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 20 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 21 | 2820303403 | Unclassified Firmicutes Th196P1bin2 | Isolate | Unclassified |
| 22 | 2820541116 | Unclassified Firmicutes Lab288P1bin109 | Isolate | Unclassified |
| 23 | 2820590132 | Unclassified Firmicutes Emb289P1bin84 | Isolate | Unclassified |
| 24 | 2820596822 | Unclassified Firmicutes Emb289P1bin58 | Isolate | Unclassified |
| 25 | 2820644600 | Unclassified Firmicutes Cu122P5bin39 | Isolate | Unclassified |
| 26 | 2820654856 | Unclassified Firmicutes Cu122P1bin2 | Isolate | Unclassified |
| 27 | 2820702360 | Unclassified Firmicutes Co191P1bin4 | Isolate | Unclassified |
| 28 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 29 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 30 | 3300021244 | Termite gut microbial communities from nest from French Guiana - 12-6 mRNA SA | Metatranscriptome | Termitidae |
| 31 | 3300021245 | Termite gut microbial communities from nest from French Guiana - 11-4 mRNA SA | Metatranscriptome | Termitidae |
| 32 | 3300022820 | Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA | Metatranscriptome | Termitidae |
| 33 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 34 | 2820298281 | Unclassified Firmicutes Th196P1bin9 | Isolate | Unclassified |
| 35 | 2820490862 | Unclassified Firmicutes Lab288P1bin64 | Isolate | Unclassified |
| 36 | 2820623020 | Unclassified Firmicutes Emb289P1bin126 | Isolate | Unclassified |
| 37 | 2820685979 | Unclassified Firmicutes Co191P1bin81 | Isolate | Unclassified |
| 38 | 2820696217 | Unclassified Firmicutes Co191P1bin66 | Isolate | Unclassified |
| 39 | 2820378768 | Unclassified Firmicutes Nt197P1bin7 | Isolate | Unclassified |
| 40 | 2820382897 | Unclassified Firmicutes Nt197P1bin3 | Isolate | Unclassified |
| 41 | 2820513949 | Unclassified Firmicutes Lab288P1bin39 | Isolate | Unclassified |
| 42 | 2820617402 | Unclassified Firmicutes Emb289P1bin131 | Isolate | Unclassified |
| 43 | 2820627938 | Unclassified Firmicutes Emb289P1bin122 | Isolate | Unclassified |
| 44 | 2820693137 | Unclassified Firmicutes Co191P1bin70 | Isolate | Unclassified |
| 45 | 2820630457 | Unclassified Firmicutes Emb289P1bin119 | Isolate | Unclassified |
| 46 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 47 | 2820375548 | Unclassified Firmicutes Nt197P1bin8 | Isolate | Unclassified |
| 48 | 2820408893 | Unclassified Firmicutes Lab288P4bin80 | Isolate | Unclassified |
| 49 | 2820427814 | Unclassified Firmicutes Lab288P3bin44 | Isolate | Unclassified |
| 50 | 2820472365 | Unclassified Firmicutes Lab288P1bin87 | Isolate | Unclassified |
| 51 | 2820615445 | Unclassified Firmicutes Emb289P1bin132 | Isolate | Unclassified |
| 52 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 53 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 54 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 55 | 2820380671 | Unclassified Firmicutes Nt197P1bin4 | Isolate | Unclassified |
| 56 | 2820432912 | Unclassified Firmicutes Lab288P3bin219 | Isolate | Unclassified |
| 57 | 2820530790 | Unclassified Firmicutes Lab288P1bin141 | Isolate | Unclassified |
| 58 | 2820600392 | Unclassified Firmicutes Emb289P1bin52 | Isolate | Unclassified |
| 59 | 2820607737 | Unclassified Firmicutes Emb289P1bin48 | Isolate | Unclassified |
| 60 | 2820663833 | Unclassified Firmicutes Co191P3bin41 | Isolate | Unclassified |
| 61 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 62 | 3300021231 | Termite gut microbial communities from nest - French Guiana - 10-1 mRNA SA | Metatranscriptome | Termitidae |
| 63 | 3300023282 | Termite gut microbial communities from Aparatermes sp. nest - French Guiana - 29-3 mRNA | Metatranscriptome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123355_10004140 | 3300009826 | Bacteria | 21036 |
| 2 | Ga0123355_10041016 | 3300009826 | Bacteria | 7535 |
| 3 | Ga0123355_10156436 | 3300009826 | Bacteria | 3447 |
| 4 | Ga0123355_10202239 | 3300009826 | Bacteria | 2898 |
| 5 | Ga0123355_10278189 | 3300009826 | Bacteria | 2315 |
| 6 | Ga0123356_12869336 | 3300010049 | Bacteria | 603 |
| 7 | Ga0123353_10203189 | 3300010167 | Bacteria | 3115 |
| 8 | Ga0123353_10514091 | 3300010167 | Bacteria | 1740 |
| 9 | Ga0123353_12351367 | 3300010167 | Bacteria | 639 |
| 10 | Ga0123354_10311313 | 3300010882 | Bacteria | 1470 |
| 11 | Ga0415639_000147 | 3300038395 | Bacteria | 10041 |
| 12 | Ga0415639_182554 | 3300038395 | Bacteria | 1542 |
| 13 | JGI24700J35501_10921390 | 3300002508 | Bacteria | 4735 |
| 14 | Ga0068305_10049264 | 3300005083 | Unclassified | 8081 |
| 15 | Ga0123355_10003980 | 3300009826 | Unclassified | 21390 |
| 16 | Ga0123355_10092698 | 3300009826 | Bacteria | 4783 |
| 17 | Ga0123355_10126201 | 3300009826 | Bacteria | 3954 |
| 18 | Ga0123355_10205168 | 3300009826 | Unclassified | 2869 |
| 19 | Ga0123355_10207718 | 3300009826 | Bacteria | 2845 |
| 20 | Ga0123355_10217597 | 3300009826 | Bacteria | 2754 |
| 21 | Ga0123355_10453617 | 3300009826 | Bacteria | 1614 |
| 22 | Ga0123355_10826594 | 3300009826 | Bacteria | 1026 |
| 23 | Ga0123355_10978462 | 3300009826 | Bacteria | 903 |
| 24 | Ga0123353_10320490 | 3300010167 | Bacteria | 2352 |
| 25 | Ga0123353_11690985 | 3300010167 | Bacteria | 793 |
| 26 | Ga0255809_1172218 | 3300022820 | Bacteria | 569 |
| 27 | Ga0255808_1030423 | 3300023282 | Bacteria | 908 |
| 28 | Ga0466714_150183 | 3300042603 | Unclassified | 1762 |
| 29 | Ga0466698_292216 | 3300042610 | Bacteria | 1064 |
| 30 | JGI24705J35276_12202688 | 3300002504 | Bacteria | 1642 |
| 31 | Ga0123355_10000631 | 3300009826 | Bacteria | 47704 |
| 32 | Ga0123355_10001116 | 3300009826 | Bacteria | 37140 |
| 33 | Ga0123355_10001506 | 3300009826 | Unclassified | 32487 |
| 34 | Ga0123355_10065063 | 3300009826 | Bacteria | 5872 |
| 35 | Ga0123355_10113850 | 3300009826 | Bacteria | 4218 |
| 36 | Ga0123355_11196183 | 3300009826 | Bacteria | 776 |
| 37 | Ga0123355_11419537 | 3300009826 | Bacteria | 684 |
| 38 | Ga0123356_10852980 | 3300010049 | Bacteria | 1082 |
| 39 | Ga0222431_1023376 | 3300021190 | Bacteria | 781 |
| 40 | Ga0466714_128064 | 3300042603 | Bacteria | 3125 |
| 41 | JGI24695J34938_10031464 | 3300002450 | Bacteria | 2462 |
| 42 | JGI24703J35330_11747068 | 3300002501 | Bacteria | 6076 |
| 43 | JGI24703J35330_11748409 | 3300002501 | Bacteria | 15643 |
| 44 | Ga0123355_10000375 | 3300009826 | Bacteria | 57436 |
| 45 | Ga0123355_10438561 | 3300009826 | Bacteria | 1655 |
| 46 | Ga0123355_10489158 | 3300009826 | Bacteria | 1525 |
| 47 | Ga0123356_10888498 | 3300010049 | Bacteria | 1062 |
| 48 | Ga0123353_11255835 | 3300010167 | Bacteria | 966 |
| 49 | Ga0415639_092212 | 3300038395 | Unclassified | 2508 |
| 50 | Ga0415639_183232 | 3300038395 | Bacteria | 1001 |
| 51 | Ga0466693_106454 | 3300042592 | Bacteria | 1430 |
| 52 | JGI24695J34938_10000288 | 3300002450 | Bacteria | 49701 |
| 53 | JGI24703J35330_11748706 | 3300002501 | Bacteria | 27345 |
| 54 | Ga0123355_10000193 | 3300009826 | Bacteria | 75741 |
| 55 | Ga0123355_10000869 | 3300009826 | Bacteria | 41744 |
| 56 | Ga0123355_10015433 | 3300009826 | Bacteria | 12001 |
| 57 | Ga0123355_10132611 | 3300009826 | Bacteria | 3834 |
| 58 | Ga0123355_10346261 | 3300009826 | Bacteria | 1974 |
| 59 | Ga0123355_10383585 | 3300009826 | Bacteria | 1828 |
| 60 | Ga0123355_10520972 | 3300009826 | Unclassified | 1454 |
| 61 | Ga0123355_10600191 | 3300009826 | Bacteria | 1307 |
| 62 | Ga0123355_11072180 | 3300009826 | Bacteria | 843 |
| 63 | Ga0123355_11385715 | 3300009826 | Bacteria | 697 |
| 64 | Ga0123356_12694050 | 3300010049 | Bacteria | 622 |
| 65 | Ga0123353_10591646 | 3300010167 | Bacteria | 1589 |
| 66 | Ga0123353_11336693 | 3300010167 | Bacteria | 927 |
| 67 | Ga0223682_1046878 | 3300021231 | Bacteria | 724 |
| 68 | Ga0223686_1049080 | 3300021244 | Bacteria | 720 |
| 69 | Ga0415639_047933 | 3300038395 | Bacteria | 1082 |
| 70 | Ga0466693_169800 | 3300042592 | Bacteria | 1667 |
| 71 | JGI24695J34938_10000253 | 3300002450 | Bacteria | 51796 |
| 72 | JGI24695J34938_10054927 | 3300002450 | Bacteria | 1724 |
| 73 | JGI24695J34938_10283354 | 3300002450 | Bacteria | 712 |
| 74 | Ga0466726_256176 | 3300042619 | Bacteria | 2284 |
| 75 | Ga0123355_10000096 | 3300009826 | Bacteria | 94059 |
| 76 | Ga0123355_10000376 | 3300009826 | Bacteria | 57406 |
| 77 | Ga0123355_10000928 | 3300009826 | Bacteria | 40502 |
| 78 | Ga0123355_10005720 | 3300009826 | Bacteria | 18266 |
| 79 | Ga0123355_10031403 | 3300009826 | Bacteria | 8618 |
| 80 | Ga0123355_10058202 | 3300009826 | Bacteria | 6253 |
| 81 | Ga0123355_10116141 | 3300009826 | Bacteria | 4165 |
| 82 | Ga0123355_10194621 | 3300009826 | Bacteria | 2976 |
| 83 | Ga0123355_10350247 | 3300009826 | Bacteria | 1957 |
| 84 | Ga0123355_10453740 | 3300009826 | Bacteria | 1614 |
| 85 | Ga0123355_11000113 | 3300009826 | Bacteria | 888 |
| 86 | Ga0223683_1003714 | 3300021245 | Bacteria | 1137 |
| 87 | Ga0415639_035037 | 3300038395 | Bacteria | 2965 |
| 88 | Ga0466693_033056 | 3300042592 | Bacteria | 4335 |
| 89 | Ga0466706_016538 | 3300042599 | Bacteria | 4696 |
| 90 | Ga0466700_470642 | 3300042600 | Bacteria | 4537 |
| 91 | Ga0466714_057974 | 3300042603 | Bacteria | 2556 |
| 92 | Ga0466714_071342 | 3300042603 | Archaea | 5940 |
| 93 | JGI24695J34938_10245703 | 3300002450 | Bacteria | 758 |
| 94 | JGI24703J35330_11748862 | 3300002501 | Bacteria | 59021 |
| 95 | Ga0123355_10000060 | 3300009826 | Bacteria | 115952 |
| 96 | Ga0123355_10000762 | 3300009826 | Unclassified | 43985 |
| 97 | Ga0123355_10001528 | 3300009826 | Bacteria | 32258 |
| 98 | Ga0123355_10032114 | 3300009826 | Bacteria | 8521 |
| 99 | Ga0123355_10052919 | 3300009826 | Bacteria | 6585 |
| 100 | Ga0123355_10146353 | 3300009826 | Bacteria | 3601 |
| 101 | Ga0123355_10639787 | 3300009826 | Bacteria | 1246 |
| 102 | Ga0123355_10737759 | 3300009826 | Bacteria | 1118 |
| 103 | Ga0123355_10900331 | 3300009826 | Bacteria | 961 |
| 104 | Ga0123353_10000174 | 3300010167 | Bacteria | 81672 |
| 105 | Ga0123353_10114000 | 3300010167 | Bacteria | 4351 |
| 106 | Ga0415639_004610 | 3300038395 | Bacteria | 49670 |
| 107 | Ga0415639_031258 | 3300038395 | Bacteria | 6639 |
| 108 | Ga0415639_083686 | 3300038395 | Bacteria | 998 |
| 109 | Ga0466693_280963 | 3300042592 | Bacteria | 1035 |
| 110 | Ga0466693_371486 | 3300042592 | Bacteria | 1543 |
| 111 | Ga0466714_092518 | 3300042603 | Bacteria | 1466 |
| 112 | JGI24703J35330_11232709 | 3300002501 | Bacteria | 787 |
| 113 | JGI24703J35330_11748707 | 3300002501 | Bacteria | 27424 |
| 114 | Ga0466704_556176 | 3300042643 | Bacteria | 31395 |
| 115 | Ga0123355_10000245 | 3300009826 | Bacteria | 69826 |
| 116 | Ga0123355_10000348 | 3300009826 | Bacteria | 59792 |
| 117 | Ga0123355_10000396 | 3300009826 | Bacteria | 56655 |
| 118 | Ga0123355_10002712 | 3300009826 | Bacteria | 25096 |
| 119 | Ga0123355_10074308 | 3300009826 | Unclassified | 5445 |
| 120 | Ga0123355_10504727 | 3300009826 | Bacteria | 1489 |
| 121 | Ga0123355_10576882 | 3300009826 | Bacteria | 1347 |
| 122 | Ga0123355_10897032 | 3300009826 | Bacteria | 964 |
| 123 | Ga0123355_11161989 | 3300009826 | Bacteria | 794 |
| 124 | Ga0123355_11787591 | 3300009826 | Bacteria | 581 |
| 125 | Ga0123356_11053677 | 3300010049 | Bacteria | 982 |
| 126 | Ga0123356_11135746 | 3300010049 | Bacteria | 949 |
| 127 | Ga0123353_10000063 | 3300010167 | Bacteria | 118144 |
| 128 | Ga0123353_10452605 | 3300010167 | Bacteria | 1889 |
| 129 | Ga0223682_1013018 | 3300021231 | Bacteria | 1070 |
| 130 | Ga0415639_143525 | 3300038395 | Bacteria | 2162 |
| 131 | Ga0466693_122142 | 3300042592 | Bacteria | 1838 |
| 132 | Ga0466693_194458 | 3300042592 | Bacteria | 2624 |
| 133 | Ga0466693_301052 | 3300042592 | Bacteria | 1109 |
| 134 | Ga0466706_021181 | 3300042599 | Bacteria | 1011 |
| 135 | Ga0466706_191259 | 3300042599 | Bacteria | 2892 |
| 136 | Ga0466714_051140 | 3300042603 | Bacteria | 1506 |
| 137 | Ga0466698_211983 | 3300042610 | Bacteria | 1081 |
| 138 | JGI24695J34938_10000123 | 3300002450 | Bacteria | 69638 |
| 139 | JGI24700J35501_10916598 | 3300002508 | Bacteria | 4058 |
| 140 | JGI24700J35501_10925594 | 3300002508 | Bacteria | 5878 |
| 141 | Ga0466723_359316 | 3300042618 | Bacteria | 1021 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00572 | Ribosomal_L13 | Ribosomal protein L13 | 14 | 130 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.