Protein Family IF00944
Metagenome
Isolate
112
Members
56
Samples
103
Scaffolds
132.03
Avg Length
Representative Sequence
- ID
- 3300002834|JGI24696J40584_12961612|JGI24696J40584_1296161222
- Length
- 150 aa
- Sequence
- MKNNTNIENGTSSTPPFGGRGGLFTKIVNGEIPSYKIAENERYYAFLDINPIVKGHTLVIPKQETDYIFDLDDETLSGLHLFAKRVARAVEKVVPCKRIAMAVLGLEVPHAHIHLLPVNKEADASITSPKQTFPAEEMQKIAEKIRSNF*
Sample Types
Isolate
8.0%
Metagenome
92.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
34.5%
Kalotermitidae
25.5%
Unclassified
9.1%
Rhinotermitidae
7.3%
Elmidae
5.5%
Termopsidae
5.5%
Passalidae
5.5%
Blattidae
3.6%
Hodotermitidae
1.8%
Tenebrionidae
1.8%
Taxonomy
Archaea
0
Bacteria
106
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 2 | 2864831662 | Chryseobacterium sediminis S00068 | Isolate | Elmidae |
| 3 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 4 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 5 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 6 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 7 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 8 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 9 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 10 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 11 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 12 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 13 | 2864822740 | Chryseobacterium shigense S00064 | Isolate | Elmidae |
| 14 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 15 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 16 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 17 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 18 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 19 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 20 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 21 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 22 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 23 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 24 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 25 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 26 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 27 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 28 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 29 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 30 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 31 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 32 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 33 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 34 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 35 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 36 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 37 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 38 | 2864882932 | Chryseobacterium shingense S00136 | Isolate | Elmidae |
| 39 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 40 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 41 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 42 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 43 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 44 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 45 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 46 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 47 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 48 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 49 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 50 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 51 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 52 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 53 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 54 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 55 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 56 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_066144 | 3300042611 | Bacteria | 115209 |
| 2 | Ga0466705_074663 | 3300042612 | Bacteria | 37612 |
| 3 | Ga0466732_108210 | 3300042656 | Bacteria | 11155 |
| 4 | Ga0123353_10481760 | 3300010167 | Bacteria | 1815 |
| 5 | Ga0123354_10410836 | 3300010882 | Bacteria | 1135 |
| 6 | Ga0466723_031620 | 3300042618 | Bacteria | 46972 |
| 7 | Ga0466691_126273 | 3300042593 | Bacteria | 2399 |
| 8 | Ga0466706_041837 | 3300042599 | Bacteria | 33853 |
| 9 | Ga0466706_151262 | 3300042599 | Bacteria | 27927 |
| 10 | Ga0466706_289342 | 3300042599 | Bacteria | 1808 |
| 11 | Ga0466713_143155 | 3300042602 | Bacteria | 188721 |
| 12 | Ga0466735_058240 | 3300042624 | Unclassified | 3740 |
| 13 | Ga0466704_499087 | 3300042643 | Bacteria | 6995 |
| 14 | Ga0466733_064811 | 3300042659 | Bacteria | 37557 |
| 15 | Ga0466733_155002 | 3300042659 | Bacteria | 5086 |
| 16 | Ga0123356_10092992 | 3300010049 | Bacteria | 2877 |
| 17 | Ga0123353_10780540 | 3300010167 | Unclassified | 1323 |
| 18 | Ga0466711_159983 | 3300042615 | Bacteria | 9920 |
| 19 | Ga0466715_234297 | 3300042616 | Bacteria | 23273 |
| 20 | Ga0466726_458023 | 3300042619 | Unclassified | 2137 |
| 21 | Ga0466728_176748 | 3300042620 | Bacteria | 5808 |
| 22 | Ga0466657_292974 | 3300042582 | Bacteria | 4484 |
| 23 | Ga0466657_403138 | 3300042582 | Bacteria | 17146 |
| 24 | Ga0466692_097566 | 3300042591 | Bacteria | 15177 |
| 25 | Ga0466691_183565 | 3300042593 | Bacteria | 2454 |
| 26 | 2227024257 | 2225789003 | Unclassified | 989 |
| 27 | IMNBL1DRAFT_c0031715 | 3300000062 | Bacteria | 1917 |
| 28 | Ga0466709_198532 | 3300042648 | Bacteria | 44178 |
| 29 | Ga0466733_135453 | 3300042659 | Bacteria | 1322 |
| 30 | Ga0562377_0018 | 3300056842 | Bacteria | 1087840 |
| 31 | Ga0123356_10185042 | 3300010049 | Bacteria | 2108 |
| 32 | Ga0123353_10721220 | 3300010167 | Bacteria | 1394 |
| 33 | Ga0466711_265626 | 3300042615 | Bacteria | 7982 |
| 34 | Ga0466723_170057 | 3300042618 | Bacteria | 2443 |
| 35 | Ga0466723_171983 | 3300042618 | Bacteria | 1960 |
| 36 | Ga0466726_097429 | 3300042619 | Bacteria | 22374 |
| 37 | Ga0466690_259999 | 3300042590 | Bacteria | 17809 |
| 38 | Ga0466691_038866 | 3300042593 | Bacteria | 19756 |
| 39 | Ga0466713_063363 | 3300042602 | Bacteria | 50941 |
| 40 | Ga0466714_074087 | 3300042603 | Bacteria | 2425 |
| 41 | Ga0466716_378206 | 3300042605 | Bacteria | 16459 |
| 42 | Ga0466719_431354 | 3300042606 | Bacteria | 5137 |
| 43 | 2227504342 | 2225789004 | Bacteria | 3723 |
| 44 | JGI24696J40584_12961612 | 3300002834 | Bacteria | 23942 |
| 45 | Ga0466725_323088 | 3300042654 | Bacteria | 35819 |
| 46 | Ga0123353_10012331 | 3300010167 | Bacteria | 12140 |
| 47 | Ga0123354_10353092 | 3300010882 | Bacteria | 1308 |
| 48 | Ga0466715_263572 | 3300042616 | Bacteria | 51738 |
| 49 | Ga0466701_055175 | 3300042598 | Bacteria | 174968 |
| 50 | Ga0466706_090233 | 3300042599 | Bacteria | 42004 |
| 51 | Ga0466706_135692 | 3300042599 | Bacteria | 21887 |
| 52 | Ga0466706_249697 | 3300042599 | Bacteria | 1855 |
| 53 | IMNBL1DRAFT_c0016241 | 3300000062 | Bacteria | 3196 |
| 54 | Ga0068302_10070384 | 3300005071 | Bacteria | 4148 |
| 55 | Ga0466708_130740 | 3300042652 | Bacteria | 21643 |
| 56 | Ga0466657_184283 | 3300042582 | Bacteria | 8458 |
| 57 | Ga0466690_055978 | 3300042590 | Bacteria | 2123 |
| 58 | Ga0466696_418161 | 3300042596 | Bacteria | 9008 |
| 59 | Ga0466701_097804 | 3300042598 | Bacteria | 1146 |
| 60 | Ga0466707_213150 | 3300042601 | Bacteria | 55646 |
| 61 | Ga0466714_058811 | 3300042603 | Bacteria | 71979 |
| 62 | Ga0072941_1045072 | 3300005201 | Bacteria | 18963 |
| 63 | Ga0466729_201709 | 3300042621 | Bacteria | 34471 |
| 64 | Ga0466734_094804 | 3300042623 | Bacteria | 13897 |
| 65 | Ga0466730_101108 | 3300042625 | Bacteria | 144008 |
| 66 | Ga0466705_127612 | 3300042612 | Bacteria | 2140 |
| 67 | Ga0466710_254218 | 3300042613 | Bacteria | 8199 |
| 68 | Ga0466711_099902 | 3300042615 | Bacteria | 11091 |
| 69 | Ga0466715_296763 | 3300042616 | Bacteria | 16157 |
| 70 | Ga0466694_225477 | 3300042594 | Bacteria | 1140 |
| 71 | Ga0466696_210001 | 3300042596 | Bacteria | 22717 |
| 72 | Ga0466714_016102 | 3300042603 | Bacteria | 35564 |
| 73 | Ga0466714_158012 | 3300042603 | Unclassified | 2364 |
| 74 | JGI24699J35502_11134215 | 3300002509 | Bacteria | 63583 |
| 75 | Ga0466703_276852 | 3300042636 | Bacteria | 1161 |
| 76 | Ga0466709_155657 | 3300042648 | Unclassified | 11514 |
| 77 | Ga0466724_39588 | 3300042649 | Bacteria | 96893 |
| 78 | Ga0466708_012438 | 3300042652 | Bacteria | 10174 |
| 79 | Ga0466725_178772 | 3300042654 | Bacteria | 45285 |
| 80 | Ga0466697_158507 | 3300042611 | Bacteria | 4675 |
| 81 | Ga0123357_10340205 | 3300009784 | Bacteria | 1452 |
| 82 | Ga0466712_260617 | 3300042614 | Bacteria | 2752 |
| 83 | Ga0466726_062091 | 3300042619 | Bacteria | 6562 |
| 84 | Ga0466692_103283 | 3300042591 | Bacteria | 43769 |
| 85 | Ga0466696_139527 | 3300042596 | Bacteria | 7738 |
| 86 | Ga0466706_081471 | 3300042599 | Bacteria | 1833 |
| 87 | Ga0466713_154345 | 3300042602 | Bacteria | 42582 |
| 88 | Ga0466716_091885 | 3300042605 | Bacteria | 6185 |
| 89 | Ga0466719_332433 | 3300042606 | Bacteria | 10113 |
| 90 | Ga0466735_081556 | 3300042624 | Bacteria | 2313 |
| 91 | Ga0466735_084118 | 3300042624 | Bacteria | 1836 |
| 92 | Ga0466708_200440 | 3300042652 | Bacteria | 16953 |
| 93 | Ga0466732_316891 | 3300042656 | Bacteria | 4138 |
| 94 | Ga0466728_098038 | 3300042620 | Bacteria | 10918 |
| 95 | Ga0466690_086334 | 3300042590 | Bacteria | 6709 |
| 96 | Ga0466696_340694 | 3300042596 | Bacteria | 5202 |
| 97 | Ga0466707_059136 | 3300042601 | Bacteria | 33975 |
| 98 | Ga0466714_045791 | 3300042603 | Bacteria | 6098 |
| 99 | Ga0466714_052195 | 3300042603 | Bacteria | 3306 |
| 100 | Ga0466722_132468 | 3300042609 | Bacteria | 12492 |
| 101 | Ga0072941_1386440 | 3300005201 | Bacteria | 1202 |
| 102 | Ga0466735_050513 | 3300042624 | Bacteria | 1784 |
| 103 | Ga0466708_081537 | 3300042652 | Bacteria | 3014 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01230 | GO:0003824 | catalytic activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.