Protein Family IF00941

Metagenome Isolate
139 Members
61 Samples
122 Scaffolds
352.05 Avg Length

🧬 Representative Sequence

ID
3300002834|JGI24696J40584_12961125|JGI24696J40584_129611253
Length
406 aa
Sequence
MSPGPIFVKLAKNFLHSFKWVMERGCGLFQGVVQEKRGRRCGVETEFPFGGVMAWQGIVAEYKSFLPISEKTPIVSLHEGNTPLIYARNLAKFLGCPFELYLKFEGLNPTGSFKDRGMTLAISKAQEEGARAVVCASTGNTSASAAAYAARAGMKAFVLIPDGKIALGKLAQAVIHGAEVLQIAGNFDEALEIVRVLSEKYPMTLVNSLNPFRIEGQKTAAFEICDVLKTAPDLHFLPLGNAGNITAYWKGYREYHSAGNAHHLPKMYGIQAEGAAPFLAGKPIANPETIATAIRIGNPASWDGAMAAKKESGGRFEAVSDEEILAAYQTIARTEGVFCEPASAASVAGLMKVLKAKELPTARVVVCTLTGHGLKDPDSACRISSLPTKLEAKLSAVEKQIEKML*

📊 Sample Types

Isolate 12.2%
Metagenome 87.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 31.6%
Kalotermitidae 24.6%
Termitidae 24.6%
Termopsidae 7.0%
Rhinotermitidae 5.3%
Calliphoridae 1.8%
Hodotermitidae 1.8%
Armadillidiidae 1.8%
Culicidae 1.8%

🌳 Taxonomy

Archaea 0
Bacteria 123
Eukaryota 0
Viruses 0
Unclassified 16

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
2 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
3 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
4 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
5 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
6 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
7 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
8 2852431164 Brevibacillus laterosporus BON707 Isolate Calliphoridae
9 2772190889 Unclassified Elusimicrobia Cu122P5_bin43 Isolate Unclassified
10 2820170025 Unclassified Proteobacteria Co191P1bin43 Isolate Unclassified
11 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
12 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
13 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
14 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
15 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
16 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
17 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
18 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
19 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
20 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
21 2820818506 Unclassified Actinobacteria Nt197P3bin3 Isolate Unclassified
22 2820849606 Unclassified Actinobacteria Lab288P3bin39 Isolate Unclassified
23 2820922474 Unclassified Actinobacteria Emb289P3bin154 Isolate Unclassified
24 2754412482 Unclassified Elusimicrobia Emb289P3bin85 Isolate Unclassified
25 2820053807 Unclassified Proteobacteria Th196P3bin117 Isolate Unclassified
26 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
27 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
28 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
29 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
30 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
31 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
32 3300012806 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG Metagenome
33 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
34 642555172 Endomicrobium trichonymphae Rs-D17 Isolate Unclassified
35 2754412483 Unclassified Elusimicrobia Lab288P4bin38 Isolate Unclassified
36 2772190893 Unclassified Elusimicrobia Nt197P4_bin29 Isolate Unclassified
37 2820168331 Unclassified Proteobacteria Co191P3bin57 Isolate Unclassified
38 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
39 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
40 2772190891 Unclassified Elusimicrobia Emb289P1_bin41 Isolate Unclassified
41 2820134530 Unclassified Proteobacteria Emb289P3bin65 Isolate Unclassified
42 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
43 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
44 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
45 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
46 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
47 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
48 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
49 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
50 2772190894 Unclassified Elusimicrobia Th196P4_bin33 Isolate Unclassified
51 2820166269 Unclassified Proteobacteria Co191P4bin16 Isolate Unclassified
52 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
53 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
54 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
55 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
56 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
57 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
58 2772190892 Unclassified Elusimicrobia Lab288P3_bin37 Isolate Unclassified
59 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
60 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
61 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466715_312179 3300042616 Bacteria 29200
2 Ga0466723_141993 3300042618 Bacteria 7496
3 Ga0466726_437684 3300042619 Bacteria 18840
4 Ga0466706_263249 3300042599 Bacteria 2405
5 Ga0466716_483786 3300042605 Bacteria 13090
6 Ga0160457_1000068 3300012858 Bacteria 166662
7 Ga0466690_357085 3300042590 Bacteria 8208
8 Ga0466692_156593 3300042591 Bacteria 10262
9 Ga0466696_377217 3300042596 Unclassified 13142
10 Ga0123356_10081872 3300010049 Bacteria 3055
11 Ga0123353_10001182 3300010167 Unclassified 31925
12 AustNasuHG_c1005099 3300000089 Bacteria 4696
13 JGI24702J35022_10001028 3300002462 Bacteria 17444
14 JGI24699J35502_11124952 3300002509 Bacteria 3727
15 Ga0466704_342819 3300042643 Bacteria 15146
16 Ga0466705_143986 3300042612 Bacteria 113378
17 Ga0466705_358949 3300042612 Unclassified 4795
18 Ga0466711_152179 3300042615 Unclassified 19214
19 Ga0466711_303978 3300042615 Bacteria 4904
20 Ga0466723_080144 3300042618 Bacteria 15273
21 Ga0466723_106583 3300042618 Bacteria 10042
22 Ga0466723_152504 3300042618 Unclassified 10651
23 Ga0466726_130216 3300042619 Bacteria 1868
24 Ga0466729_080834 3300042621 Bacteria 4399
25 Ga0466714_019678 3300042603 Bacteria 23480
26 Ga0466716_209027 3300042605 Bacteria 15630
27 Ga0160453_104278 3300012814 Bacteria 2668
28 Ga0466690_053135 3300042590 Unclassified 11667
29 Ga0123356_10001429 3300010049 Unclassified 26418
30 Ga0123353_10227625 3300010167 Bacteria 2910
31 Ga0068302_10150201 3300005071 Bacteria 1260
32 Ga0466734_164085 3300042623 Bacteria 8480
33 Ga0466704_459543 3300042643 Bacteria 5809
34 Ga0466725_364818 3300042654 Bacteria 6515
35 Ga0466715_213326 3300042616 Bacteria 1469
36 Ga0466715_297517 3300042616 Bacteria 34381
37 Ga0466728_035165 3300042620 Bacteria 39347
38 Ga0466728_126837 3300042620 Bacteria 6677
39 Ga0466706_254954 3300042599 Bacteria 21529
40 Ga0466722_005768 3300042609 Bacteria 9297
41 Ga0123354_10001270 3300010882 Bacteria 29971
42 JGI24699J35502_11133765 3300002509 Bacteria 15037
43 Ga0466729_240520 3300042621 Bacteria 2410
44 Ga0466704_286239 3300042643 Unclassified 6725
45 Ga0466704_546462 3300042643 Bacteria 26528
46 Ga0466704_552082 3300042643 Bacteria 15742
47 Ga0466705_163529 3300042612 Bacteria 36737
48 Ga0466711_117944 3300042615 Bacteria 215972
49 Ga0466711_449830 3300042615 Bacteria 1649
50 Ga0466723_085453 3300042618 Bacteria 73497
51 Ga0466723_289367 3300042618 Bacteria 62014
52 Ga0466707_057336 3300042601 Bacteria 145123
53 Ga0466716_081603 3300042605 Bacteria 7289
54 Ga0466719_068744 3300042606 Bacteria 48898
55 Ga0160452_100091 3300012834 Bacteria 119942
56 Ga0466656_055034 3300042550 Bacteria 1562
57 Ga0466691_015920 3300042593 Bacteria 62881
58 JGI24705J35276_12238736 3300002504 Bacteria 48239
59 Ga0466703_245834 3300042636 Bacteria 11270
60 Ga0466703_395188 3300042636 Bacteria 299836
61 Ga0466709_233182 3300042648 Bacteria 91749
62 Ga0466728_134295 3300042620 Bacteria 11818
63 Ga0466706_037575 3300042599 Bacteria 87054
64 Ga0466719_033732 3300042606 Bacteria 51056
65 Ga0264413_119869 3300024493 Bacteria 7158
66 Ga0466690_027505 3300042590 Bacteria 56259
67 Ga0466690_328962 3300042590 Bacteria 9147
68 Ga0466693_218291 3300042592 Bacteria 114325
69 Ga0068302_10014963 3300005071 Bacteria 5674
70 Ga0466735_033751 3300042624 Bacteria 5071
71 Ga0466704_284247 3300042643 Unclassified 4960
72 Ga0466725_426626 3300042654 Bacteria 2534
73 Ga0466705_373837 3300042612 Bacteria 12583
74 Ga0466711_127527 3300042615 Bacteria 31105
75 Ga0466711_386870 3300042615 Bacteria 27275
76 Ga0466715_046636 3300042616 Bacteria 70768
77 Ga0466715_340214 3300042616 Unclassified 3147
78 Ga0466728_336939 3300042620 Bacteria 13341
79 Ga0466729_016754 3300042621 Bacteria 37408
80 Ga0466719_110680 3300042606 Bacteria 14333
81 Ga0466719_163396 3300042606 Bacteria 5601
82 Ga0123356_10004106 3300010049 Bacteria 15123
83 Ga0123356_10341736 3300010049 Bacteria 1617
84 JGI24696J40584_12961125 3300002834 Bacteria 11022
85 Ga0068305_10000924 3300005083 Unclassified 65035
86 Ga0466729_268858 3300042621 Bacteria 59050
87 Ga0466735_039712 3300042624 Bacteria 14788
88 Ga0466703_205020 3300042636 Bacteria 117626
89 Ga0466704_104107 3300042643 Bacteria 6460
90 Ga0466727_298426 3300042655 Bacteria 81478
91 Ga0466711_089711 3300042615 Bacteria 19674
92 Ga0466715_115336 3300042616 Bacteria 10605
93 Ga0466723_264127 3300042618 Bacteria 16085
94 Ga0466726_047707 3300042619 Bacteria 62318
95 Ga0466726_099748 3300042619 Bacteria 172717
96 Ga0466728_070494 3300042620 Bacteria 11218
97 Ga0466707_096029 3300042601 Bacteria 9378
98 Ga0466722_009279 3300042609 Bacteria 1715
99 Ga0466691_051057 3300042593 Bacteria 5095
100 Ga0123356_10145359 3300010049 Bacteria 2345
101 Ga0068305_10205850 3300005083 Bacteria 3051
102 Ga0466704_086571 3300042643 Bacteria 65985
103 Ga0466704_201577 3300042643 Bacteria 32720
104 Ga0466705_388248 3300042612 Bacteria 16143
105 Ga0466715_026286 3300042616 Bacteria 37068
106 Ga0466723_179660 3300042618 Bacteria 5516
107 Ga0466726_057733 3300042619 Bacteria 7920
108 Ga0466726_186470 3300042619 Bacteria 4299
109 Ga0466726_284750 3300042619 Unclassified 20964
110 Ga0466722_060636 3300042609 Bacteria 6497
111 Ga0160447_100025 3300012849 Bacteria 240193
112 Ga0466690_012951 3300042590 Bacteria 1605
113 Ga0466690_152083 3300042590 Bacteria 3409
114 Ga0466690_228886 3300042590 Bacteria 7745
115 Ga0466691_128099 3300042593 Unclassified 7720
116 Ga0466696_233593 3300042596 Bacteria 3453
117 Ga0123357_10048511 3300009784 Bacteria 5754
118 Ga0123356_10004747 3300010049 Unclassified 14003
119 Ga0123356_10160050 3300010049 Unclassified 2247
120 Ga0160442_100214 3300012806 Bacteria 45764
121 Ga0466704_524423 3300042643 Unclassified 11486
122 Ga0466708_240445 3300042652 Bacteria 4310

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00291 PALP Pyridoxal-phosphate dependent enzyme 75 371 0.95

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.