Protein Family IF00931
Metagenome
Isolate
181
Members
73
Samples
156
Scaffolds
305.98
Avg Length
Representative Sequence
- ID
- 3300002834|JGI24696J40584_12913498|JGI24696J40584_129134982
- Length
- 351 aa
- Sequence
- MGLFCKNIGFNRSHENCERLIFTTFHKLFFINFFLKSHIPDIRIWFFFVVMGKYELITILGPTACGKTQLAAALAAKLRSEVISADSRQVYRRMDIGTGKDLDDYIVDGRPIPYHLVDICEPGTKYNVFRYQHDFFTIFNKLKNAGLIPVLCGGTGMYIEAVLKGYKLLDVPPNPALRRSLAGKSLEELEQKLANYKTLHNKTDVDSAQRAIRAIEIEEYYQHEAPGNSEFVPLQSLIIGIDIDRELRREKISKLSEGMIDEVSRLLDDGIPPGDLIYYGLEYKYITQYLIGELTYDEMTSLLEIAIHQFAKRQMTWFRGMERRGFAIHWIDAAIALEEKIEKTLTFFNN*
Sample Types
Isolate
13.8%
Metagenome
86.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
23.6%
Kalotermitidae
19.4%
Blattidae
19.4%
Unclassified
12.5%
Rhinotermitidae
6.9%
Termopsidae
5.6%
Passalidae
4.2%
Hydrophilidae
2.8%
Drosophilidae
2.8%
Elmidae
1.4%
Tenebrionidae
1.4%
Taxonomy
Archaea
0
Bacteria
179
Eukaryota
0
Viruses
0
Unclassified
2
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 2 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 3 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 4 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 5 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 6 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 7 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 8 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 9 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 10 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 11 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 12 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 13 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 14 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 15 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 16 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 17 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 18 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 19 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 20 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 21 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 22 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 23 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 24 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 25 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 26 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 27 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 28 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 29 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 30 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 31 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 32 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 33 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 34 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 35 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 36 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 37 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 38 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 39 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 40 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 41 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 42 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 43 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 44 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 45 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 46 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 47 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 48 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 49 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 50 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 51 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 52 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 53 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 54 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 55 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 56 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 57 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 58 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 59 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 60 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 61 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 62 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 63 | 2864836148 | Arcicella rosea S00070 | Isolate | Elmidae |
| 64 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 65 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 66 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 67 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 68 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 69 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 70 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 71 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 72 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 73 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466656_048535 | 3300042550 | Bacteria | 1795 |
| 2 | Ga0466705_083430 | 3300042612 | Bacteria | 16371 |
| 3 | Ga0466732_110914 | 3300042656 | Bacteria | 1884 |
| 4 | Ga0466732_116143 | 3300042656 | Bacteria | 1529 |
| 5 | Ga0123353_10663435 | 3300010167 | Bacteria | 1473 |
| 6 | Ga0123354_10202022 | 3300010882 | Unclassified | 2181 |
| 7 | Ga0466705_528456 | 3300042612 | Bacteria | 2107 |
| 8 | Ga0466711_115367 | 3300042615 | Bacteria | 12045 |
| 9 | Ga0466715_015382 | 3300042616 | Bacteria | 25238 |
| 10 | Ga0466723_053883 | 3300042618 | Bacteria | 24209 |
| 11 | Ga0466728_196439 | 3300042620 | Bacteria | 1398 |
| 12 | Ga0466729_280150 | 3300042621 | Bacteria | 10011 |
| 13 | Ga0466735_022781 | 3300042624 | Bacteria | 3707 |
| 14 | Ga0466735_217254 | 3300042624 | Bacteria | 2527 |
| 15 | Ga0466704_305943 | 3300042643 | Bacteria | 4300 |
| 16 | Ga0466709_066569 | 3300042648 | Bacteria | 14891 |
| 17 | 2227219681 | 2225789004 | Bacteria | 33222 |
| 18 | 2227590445 | 2225789004 | Bacteria | 2427 |
| 19 | IMNBL1DRAFT_c0001047 | 3300000062 | Bacteria | 21395 |
| 20 | Ga0072941_1328562 | 3300005201 | Bacteria | 4547 |
| 21 | Ga0466707_097852 | 3300042601 | Bacteria | 26513 |
| 22 | Ga0466707_290683 | 3300042601 | Bacteria | 3812 |
| 23 | Ga0466713_053120 | 3300042602 | Bacteria | 1526 |
| 24 | Ga0466713_108443 | 3300042602 | Bacteria | 74837 |
| 25 | Ga0466719_157724 | 3300042606 | Bacteria | 3512 |
| 26 | Ga0466691_013448 | 3300042593 | Bacteria | 43223 |
| 27 | Ga0466696_182096 | 3300042596 | Bacteria | 20260 |
| 28 | Ga0466705_246819 | 3300042612 | Bacteria | 3216 |
| 29 | Ga0466733_095748 | 3300042659 | Bacteria | 6918 |
| 30 | Ga0123353_10290670 | 3300010167 | Bacteria | 2502 |
| 31 | Ga0466723_087560 | 3300042618 | Bacteria | 3559 |
| 32 | Ga0466704_594161 | 3300042643 | Bacteria | 15028 |
| 33 | Ga0466709_099822 | 3300042648 | Bacteria | 2618 |
| 34 | Ga0466708_042034 | 3300042652 | Bacteria | 19165 |
| 35 | Ga0466727_176210 | 3300042655 | Bacteria | 12726 |
| 36 | Ga0466727_221672 | 3300042655 | Bacteria | 9440 |
| 37 | 2227047025 | 2225789003 | Bacteria | 4065 |
| 38 | IMNBL1DRAFT_c0000445 | 3300000062 | Bacteria | 34629 |
| 39 | Ga0068302_10162501 | 3300005071 | Bacteria | 9312 |
| 40 | Ga0068305_10003714 | 3300005083 | Bacteria | 240854 |
| 41 | Ga0466713_153072 | 3300042602 | Bacteria | 7373 |
| 42 | Ga0466716_105802 | 3300042605 | Bacteria | 11974 |
| 43 | Ga0466726_194939 | 3300042619 | Bacteria | 5588 |
| 44 | Ga0466729_037737 | 3300042621 | Bacteria | 5312 |
| 45 | Ga0466735_117983 | 3300042624 | Bacteria | 1149 |
| 46 | Ga0466704_249834 | 3300042643 | Bacteria | 14240 |
| 47 | Ga0466704_461175 | 3300042643 | Bacteria | 21896 |
| 48 | Ga0466709_181932 | 3300042648 | Bacteria | 8400 |
| 49 | JGI24702J35022_10019340 | 3300002462 | Bacteria | 3704 |
| 50 | Ga0466713_122611 | 3300042602 | Bacteria | 62960 |
| 51 | Ga0466713_151541 | 3300042602 | Bacteria | 1876 |
| 52 | Ga0466722_219492 | 3300042609 | Bacteria | 63959 |
| 53 | Ga0466656_064855 | 3300042550 | Bacteria | 7925 |
| 54 | Ga0466690_372984 | 3300042590 | Bacteria | 6524 |
| 55 | Ga0466696_282740 | 3300042596 | Bacteria | 3311 |
| 56 | Ga0466705_375359 | 3300042612 | Bacteria | 8509 |
| 57 | Ga0466733_150639 | 3300042659 | Bacteria | 185699 |
| 58 | Ga0123353_10110979 | 3300010167 | Bacteria | 4417 |
| 59 | Ga0123353_10218942 | 3300010167 | Bacteria | 2979 |
| 60 | Ga0123354_10000089 | 3300010882 | Bacteria | 67418 |
| 61 | Ga0466711_001110 | 3300042615 | Bacteria | 4120 |
| 62 | Ga0466711_043535 | 3300042615 | Bacteria | 2813 |
| 63 | Ga0466726_324871 | 3300042619 | Bacteria | 9558 |
| 64 | Ga0466729_242909 | 3300042621 | Bacteria | 9408 |
| 65 | Ga0466731_074700 | 3300042622 | Bacteria | 1773 |
| 66 | Ga0466735_016539 | 3300042624 | Bacteria | 2786 |
| 67 | Ga0466735_042327 | 3300042624 | Bacteria | 6599 |
| 68 | Ga0466735_214120 | 3300042624 | Bacteria | 2395 |
| 69 | Ga0466704_477034 | 3300042643 | Bacteria | 56056 |
| 70 | Ga0466709_292580 | 3300042648 | Bacteria | 8167 |
| 71 | Ga0466708_158188 | 3300042652 | Bacteria | 11597 |
| 72 | 2227194692 | 2225789004 | Bacteria | 7872 |
| 73 | 2227208575 | 2225789004 | Bacteria | 7661 |
| 74 | 2227624343 | 2225789004 | Bacteria | 2166 |
| 75 | IMNBL1DRAFT_c0001301 | 3300000062 | Bacteria | 18778 |
| 76 | IMNBL1DRAFT_c0012863 | 3300000062 | Bacteria | 3796 |
| 77 | Ga0072941_1100677 | 3300005201 | Bacteria | 1076 |
| 78 | Ga0466713_094824 | 3300042602 | Bacteria | 7740 |
| 79 | Ga0466722_085395 | 3300042609 | Bacteria | 6738 |
| 80 | Ga0466692_055993 | 3300042591 | Bacteria | 22917 |
| 81 | Ga0466695_018344 | 3300042595 | Bacteria | 1225 |
| 82 | Ga0466696_010340 | 3300042596 | Bacteria | 2105 |
| 83 | Ga0466696_347362 | 3300042596 | Bacteria | 2340 |
| 84 | Ga0466733_194561 | 3300042659 | Bacteria | 3706 |
| 85 | Ga0123353_10000423 | 3300010167 | Bacteria | 52369 |
| 86 | Ga0466705_476770 | 3300042612 | Bacteria | 2615 |
| 87 | Ga0466715_042870 | 3300042616 | Bacteria | 20678 |
| 88 | Ga0466735_003202 | 3300042624 | Bacteria | 2408 |
| 89 | Ga0466735_127635 | 3300042624 | Bacteria | 5896 |
| 90 | Ga0466703_281297 | 3300042636 | Bacteria | 25783 |
| 91 | 2227549628 | 2225789004 | Bacteria | 15100 |
| 92 | IMNBL1DRAFT_c0023340 | 3300000062 | Bacteria | 2425 |
| 93 | Ga0068305_10022352 | 3300005083 | Bacteria | 4759 |
| 94 | Ga0466701_040623 | 3300042598 | Bacteria | 5837 |
| 95 | Ga0466690_198924 | 3300042590 | Bacteria | 34985 |
| 96 | Ga0466692_021569 | 3300042591 | Bacteria | 21084 |
| 97 | Ga0466692_178028 | 3300042591 | Bacteria | 52823 |
| 98 | Ga0466732_107536 | 3300042656 | Bacteria | 2115 |
| 99 | Ga0466715_397426 | 3300042616 | Bacteria | 7446 |
| 100 | Ga0466728_119130 | 3300042620 | Bacteria | 6221 |
| 101 | Ga0466703_216689 | 3300042636 | Bacteria | 4203 |
| 102 | Ga0466704_179371 | 3300042643 | Bacteria | 2502 |
| 103 | Ga0466704_204492 | 3300042643 | Bacteria | 7540 |
| 104 | Ga0466704_410802 | 3300042643 | Bacteria | 7905 |
| 105 | Ga0466708_115755 | 3300042652 | Bacteria | 3876 |
| 106 | JGI24702J35022_10000263 | 3300002462 | Bacteria | 30153 |
| 107 | JGI24696J40584_12913498 | 3300002834 | Bacteria | 1277 |
| 108 | Ga0104045_1002683 | 3300007085 | Bacteria | 10439 |
| 109 | Ga0104050_1026244 | 3300007153 | Unclassified | 5093 |
| 110 | Ga0123357_10002435 | 3300009784 | Bacteria | 20755 |
| 111 | Ga0466707_294616 | 3300042601 | Bacteria | 11241 |
| 112 | Ga0466716_228227 | 3300042605 | Bacteria | 1123 |
| 113 | Ga0466696_217568 | 3300042596 | Bacteria | 3354 |
| 114 | Ga0466733_191183 | 3300042659 | Bacteria | 11165 |
| 115 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 116 | Ga0123356_10107660 | 3300010049 | Bacteria | 2686 |
| 117 | Ga0466711_231770 | 3300042615 | Bacteria | 8785 |
| 118 | Ga0466723_139149 | 3300042618 | Bacteria | 10549 |
| 119 | Ga0466723_156953 | 3300042618 | Bacteria | 17921 |
| 120 | Ga0466726_462348 | 3300042619 | Bacteria | 3178 |
| 121 | Ga0466735_169458 | 3300042624 | Bacteria | 5199 |
| 122 | Ga0466703_112018 | 3300042636 | Bacteria | 5343 |
| 123 | Ga0466703_170391 | 3300042636 | Bacteria | 1387 |
| 124 | Ga0466708_090677 | 3300042652 | Bacteria | 10969 |
| 125 | Ga0466725_043597 | 3300042654 | Bacteria | 2777 |
| 126 | Ga0466727_102846 | 3300042655 | Bacteria | 3188 |
| 127 | 2227498242 | 2225789004 | Bacteria | 3874 |
| 128 | IMNBL1DRAFT_c0000531 | 3300000062 | Bacteria | 31199 |
| 129 | IMNBL1DRAFT_c0004317 | 3300000062 | Bacteria | 8590 |
| 130 | IMNBL1DRAFT_c0004926 | 3300000062 | Bacteria | 7823 |
| 131 | JGI24702J35022_10005949 | 3300002462 | Bacteria | 7089 |
| 132 | Ga0068305_10007915 | 3300005083 | Bacteria | 15522 |
| 133 | Ga0466700_366422 | 3300042600 | Bacteria | 11322 |
| 134 | Ga0466707_123870 | 3300042601 | Bacteria | 6339 |
| 135 | Ga0466707_201232 | 3300042601 | Bacteria | 18378 |
| 136 | Ga0466707_217250 | 3300042601 | Bacteria | 4926 |
| 137 | Ga0466713_045311 | 3300042602 | Bacteria | 10275 |
| 138 | Ga0466714_121243 | 3300042603 | Bacteria | 51129 |
| 139 | Ga0466698_186782 | 3300042610 | Bacteria | 5035 |
| 140 | Ga0466656_138456 | 3300042550 | Bacteria | 1182 |
| 141 | Ga0466696_110710 | 3300042596 | Bacteria | 2563 |
| 142 | Ga0466705_132072 | 3300042612 | Bacteria | 8395 |
| 143 | Ga0466733_210608 | 3300042659 | Bacteria | 40939 |
| 144 | Ga0123357_10006965 | 3300009784 | Bacteria | 13898 |
| 145 | Ga0123356_10707743 | 3300010049 | Bacteria | 1176 |
| 146 | Ga0466723_239231 | 3300042618 | Bacteria | 2811 |
| 147 | Ga0466709_047096 | 3300042648 | Bacteria | 173163 |
| 148 | Ga0466727_102563 | 3300042655 | Bacteria | 12294 |
| 149 | JGI24705J35276_12234823 | 3300002504 | Bacteria | 5887 |
| 150 | Ga0466700_373334 | 3300042600 | Bacteria | 80469 |
| 151 | Ga0466707_155022 | 3300042601 | Bacteria | 6129 |
| 152 | Ga0466707_404342 | 3300042601 | Bacteria | 2787 |
| 153 | Ga0466713_043591 | 3300042602 | Bacteria | 53812 |
| 154 | Ga0466713_122827 | 3300042602 | Bacteria | 174567 |
| 155 | Ga0466716_494654 | 3300042605 | Bacteria | 6477 |
| 156 | Ga0466722_244529 | 3300042609 | Bacteria | 1968 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01715 | IPPT | IPP transferase | 89 | 320 | 0.89 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.