Protein Family IF00910
Metagenome
Isolate
191
Members
57
Samples
184
Scaffolds
108.88
Avg Length
Representative Sequence
- ID
- 3300002509|JGI24699J35502_10745088|JGI24699J35502_107450881
- Length
- 127 aa
- Sequence
- MRRGEVWYARFEPAQGSEANKTRTCVIVSADAGNRTAERLGRGVITVVPLTTNIARVYEFQALISASPSTGLARDSKAQAEQVRSLDVTRFDRRIGVLSREQMTAVEAALMSHLALGTFGMGISGS*
Sample Types
Isolate
3.7%
Metagenome
96.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
52.7%
Kalotermitidae
16.4%
Unclassified
12.7%
Formicidae
5.5%
Termopsidae
5.5%
Rhinotermitidae
3.6%
Scarabaeidae
1.8%
Hodotermitidae
1.8%
Taxonomy
Archaea
2
Bacteria
168
Eukaryota
0
Viruses
1
Unclassified
20
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 4 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 7 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 11 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 12 | 2820931684 | Unclassified Actinobacteria Emb289P1bin89 | Isolate | Unclassified |
| 13 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 14 | 2884613238 | Agromyces intestinalis KACC 19306 | Isolate | Scarabaeidae |
| 15 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 16 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 17 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 18 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 19 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 20 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 21 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 22 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 23 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 24 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 25 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 26 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 27 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 28 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 29 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 30 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 31 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 32 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 33 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 34 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 35 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 36 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 37 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 38 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 39 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 40 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 41 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 42 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 43 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 44 | 2781125648 | Treponema sp. Co191P3bin70 | Isolate | Unclassified |
| 45 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 46 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 47 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 48 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 49 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 50 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 51 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 52 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 53 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 54 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 55 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 56 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 57 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466706_042085 | 3300042599 | Bacteria | 99765 |
| 2 | Ga0123356_10885234 | 3300010049 | Bacteria | 1064 |
| 3 | Ga0123356_13500449 | 3300010049 | Bacteria | 544 |
| 4 | Ga0123353_10902494 | 3300010167 | Bacteria | 1203 |
| 5 | Ga0123354_10028144 | 3300010882 | Bacteria | 8852 |
| 6 | Ga0466703_062088 | 3300042636 | Bacteria | 1345 |
| 7 | Ga0466725_219782 | 3300042654 | Bacteria | 3359 |
| 8 | Ga0466712_307627 | 3300042614 | Bacteria | 5152 |
| 9 | Ga0466711_127254 | 3300042615 | Bacteria | 1572 |
| 10 | Ga0466726_393149 | 3300042619 | Bacteria | 2368 |
| 11 | Ga0466657_326606 | 3300042582 | Bacteria | 1185 |
| 12 | Ga0466694_309969 | 3300042594 | Bacteria | 1048 |
| 13 | Ga0466699_036931 | 3300042597 | Bacteria | 2553 |
| 14 | Ga0466699_070073 | 3300042597 | Bacteria | 2535 |
| 15 | JGI24698J34947_10057533 | 3300002449 | Bacteria | 1928 |
| 16 | JGI24698J34947_10075846 | 3300002449 | Bacteria | 1596 |
| 17 | JGI24698J34947_10076880 | 3300002449 | Bacteria | 1581 |
| 18 | JGI24695J34938_10000684 | 3300002450 | Bacteria | 32005 |
| 19 | JGI24695J34938_10006351 | 3300002450 | Bacteria | 7134 |
| 20 | JGI24695J34938_10095722 | 3300002450 | Archaea | 1216 |
| 21 | JGI24695J34938_10150436 | 3300002450 | Bacteria | 954 |
| 22 | JGI24699J35502_11134221 | 3300002509 | Bacteria | 67001 |
| 23 | Ga0072941_1001242 | 3300005201 | Bacteria | 15949 |
| 24 | Ga0466732_323680 | 3300042656 | Bacteria | 3945 |
| 25 | Ga0466732_391879 | 3300042656 | Bacteria | 1187 |
| 26 | Ga0466720_006407 | 3300042607 | Bacteria | 4542 |
| 27 | Ga0466720_026352 | 3300042607 | Unclassified | 1054 |
| 28 | Ga0123355_10405675 | 3300009826 | Bacteria | 1754 |
| 29 | Ga0123355_10939207 | 3300009826 | Bacteria | 931 |
| 30 | Ga0123356_11133376 | 3300010049 | Bacteria | 950 |
| 31 | Ga0123353_10541041 | 3300010167 | Bacteria | 1683 |
| 32 | Ga0123353_13317733 | 3300010167 | Bacteria | 513 |
| 33 | Ga0123354_10029781 | 3300010882 | Bacteria | 8582 |
| 34 | Ga0466704_180755 | 3300042643 | Bacteria | 1243 |
| 35 | Ga0466727_034745 | 3300042655 | Bacteria | 1788 |
| 36 | Ga0466715_408469 | 3300042616 | Bacteria | 4606 |
| 37 | Ga0264413_109685 | 3300024493 | Bacteria | 5938 |
| 38 | Ga0466692_197393 | 3300042591 | Bacteria | 1801 |
| 39 | Ga0466694_184322 | 3300042594 | Bacteria | 2567 |
| 40 | Ga0466694_267222 | 3300042594 | Bacteria | 3551 |
| 41 | AustNasuHG_c1033276 | 3300000089 | Bacteria | 1408 |
| 42 | JGI24698J34947_10148462 | 3300002449 | Bacteria | 977 |
| 43 | JGI24698J34947_10318623 | 3300002449 | Bacteria | 554 |
| 44 | JGI24699J35502_10745088 | 3300002509 | Bacteria | 812 |
| 45 | Ga0103263_102102 | 3300007042 | Bacteria | 2495 |
| 46 | Ga0466707_129491 | 3300042601 | Bacteria | 1805 |
| 47 | Ga0466720_174441 | 3300042607 | Bacteria | 5404 |
| 48 | Ga0123357_10409887 | 3300009784 | Bacteria | 1223 |
| 49 | Ga0123356_10167526 | 3300010049 | Bacteria | 2203 |
| 50 | Ga0123356_10356499 | 3300010049 | Bacteria | 1588 |
| 51 | Ga0123356_11172758 | 3300010049 | Bacteria | 935 |
| 52 | Ga0123353_11956739 | 3300010167 | Bacteria | 720 |
| 53 | Ga0123353_12737187 | 3300010167 | Bacteria | 580 |
| 54 | Ga0466731_374786 | 3300042622 | Bacteria | 2307 |
| 55 | Ga0466708_025312 | 3300042652 | Unclassified | 1330 |
| 56 | Ga0466727_243032 | 3300042655 | Bacteria | 2686 |
| 57 | Ga0466712_076416 | 3300042614 | Unclassified | 9337 |
| 58 | Ga0466712_287493 | 3300042614 | Bacteria | 3862 |
| 59 | Ga0466718_111252 | 3300042617 | Bacteria | 2511 |
| 60 | Ga0466696_138403 | 3300042596 | Bacteria | 2936 |
| 61 | Ga0466699_243742 | 3300042597 | Unclassified | 1045 |
| 62 | AustNasuHG_c1048976 | 3300000089 | Bacteria | 923 |
| 63 | JGI24698J34947_10029117 | 3300002449 | Bacteria | 2920 |
| 64 | JGI24702J35022_10001366 | 3300002462 | Bacteria | 15144 |
| 65 | Ga0466707_127033 | 3300042601 | Bacteria | 2481 |
| 66 | Ga0466698_232677 | 3300042610 | Bacteria | 3853 |
| 67 | Ga0123356_10290625 | 3300010049 | Bacteria | 1735 |
| 68 | Ga0123356_11891987 | 3300010049 | Bacteria | 743 |
| 69 | Ga0123356_12155988 | 3300010049 | Bacteria | 696 |
| 70 | Ga0123356_13986948 | 3300010049 | Bacteria | 509 |
| 71 | Ga0123353_10898011 | 3300010167 | Bacteria | 1207 |
| 72 | Ga0123353_12673175 | 3300010167 | Bacteria | 588 |
| 73 | Ga0466727_077831 | 3300042655 | Bacteria | 1384 |
| 74 | Ga0466711_490656 | 3300042615 | Bacteria | 7358 |
| 75 | Ga0466715_616117 | 3300042616 | Bacteria | 6784 |
| 76 | Ga0466693_329193 | 3300042592 | Bacteria | 1031 |
| 77 | Ga0466699_356757 | 3300042597 | Bacteria | 2170 |
| 78 | Ga0466699_427269 | 3300042597 | Bacteria | 1700 |
| 79 | JGI24698J34947_10007267 | 3300002449 | Unclassified | 6084 |
| 80 | JGI24698J34947_10015312 | 3300002449 | Bacteria | 4175 |
| 81 | JGI24698J34947_10067567 | 3300002449 | Bacteria | 1734 |
| 82 | JGI24695J34938_10000130 | 3300002450 | Bacteria | 67854 |
| 83 | JGI24705J35276_12222548 | 3300002504 | Bacteria | 2429 |
| 84 | Ga0072941_1020902 | 3300005201 | Bacteria | 1257 |
| 85 | Ga0072941_1028553 | 3300005201 | Bacteria | 10817 |
| 86 | Ga0103260_1005519 | 3300007139 | Bacteria | 1857 |
| 87 | Ga0102737_1001070 | 3300007142 | Unclassified | 8014 |
| 88 | Ga0466732_360894 | 3300042656 | Bacteria | 1064 |
| 89 | Ga0466707_129241 | 3300042601 | Bacteria | 1662 |
| 90 | Ga0466721_176391 | 3300042608 | Bacteria | 1205 |
| 91 | Ga0466698_460317 | 3300042610 | Bacteria | 1195 |
| 92 | Ga0123357_10045837 | 3300009784 | Bacteria | 5930 |
| 93 | Ga0123356_10041751 | 3300010049 | Unclassified | 4274 |
| 94 | Ga0123356_10222519 | 3300010049 | Unclassified | 1945 |
| 95 | Ga0123356_10260692 | 3300010049 | Bacteria | 1817 |
| 96 | Ga0123353_10701646 | 3300010167 | Bacteria | 1420 |
| 97 | Ga0466734_032096 | 3300042623 | Bacteria | 1811 |
| 98 | Ga0466709_199629 | 3300042648 | Unclassified | 1215 |
| 99 | Ga0466709_221871 | 3300042648 | Viruses | 5549 |
| 100 | Ga0466712_046296 | 3300042614 | Bacteria | 40974 |
| 101 | Ga0466718_027030 | 3300042617 | Bacteria | 1222 |
| 102 | Ga0466723_019104 | 3300042618 | Bacteria | 3489 |
| 103 | Ga0264413_105273 | 3300024493 | Bacteria | 3153 |
| 104 | Ga0415639_028650 | 3300038395 | Bacteria | 2888 |
| 105 | Ga0466694_076649 | 3300042594 | Bacteria | 2357 |
| 106 | Ga0466694_090143 | 3300042594 | Bacteria | 1170 |
| 107 | Ga0466695_289244 | 3300042595 | Bacteria | 1283 |
| 108 | JGI24695J34938_10185002 | 3300002450 | Bacteria | 863 |
| 109 | Ga0466732_095542 | 3300042656 | Unclassified | 5407 |
| 110 | Ga0466707_352838 | 3300042601 | Bacteria | 1203 |
| 111 | Ga0466720_099677 | 3300042607 | Bacteria | 9757 |
| 112 | Ga0466720_155204 | 3300042607 | Bacteria | 1418 |
| 113 | Ga0123355_10375735 | 3300009826 | Bacteria | 1857 |
| 114 | Ga0123356_10013410 | 3300010049 | Bacteria | 7912 |
| 115 | Ga0123356_10014691 | 3300010049 | Bacteria | 7525 |
| 116 | Ga0123356_10741269 | 3300010049 | Bacteria | 1152 |
| 117 | Ga0123356_10770848 | 3300010049 | Bacteria | 1132 |
| 118 | Ga0123353_10645087 | 3300010167 | Bacteria | 1500 |
| 119 | Ga0466735_190653 | 3300042624 | Bacteria | 14106 |
| 120 | Ga0466702_408848 | 3300042635 | Bacteria | 2818 |
| 121 | Ga0466704_399432 | 3300042643 | Bacteria | 11635 |
| 122 | Ga0466709_387723 | 3300042648 | Bacteria | 13748 |
| 123 | Ga0466727_204290 | 3300042655 | Bacteria | 3611 |
| 124 | Ga0466711_151643 | 3300042615 | Bacteria | 9486 |
| 125 | Ga0466715_293136 | 3300042616 | Bacteria | 8347 |
| 126 | Ga0466715_577417 | 3300042616 | Bacteria | 13510 |
| 127 | Ga0466718_012341 | 3300042617 | Bacteria | 8034 |
| 128 | Ga0466726_480422 | 3300042619 | Bacteria | 4715 |
| 129 | Ga0466729_108350 | 3300042621 | Bacteria | 2842 |
| 130 | JGI24698J34947_10000904 | 3300002449 | Unclassified | 15046 |
| 131 | JGI24698J34947_10113654 | 3300002449 | Bacteria | 1189 |
| 132 | JGI24698J34947_10142065 | 3300002449 | Bacteria | 1010 |
| 133 | JGI24695J34938_10600597 | 3300002450 | Unclassified | 512 |
| 134 | Ga0072940_1108012 | 3300005200 | Unclassified | 837 |
| 135 | Ga0072940_1186419 | 3300005200 | Bacteria | 615 |
| 136 | Ga0072941_1089936 | 3300005201 | Bacteria | 3322 |
| 137 | Ga0466705_247086 | 3300042612 | Bacteria | 6479 |
| 138 | Ga0123357_10019107 | 3300009784 | Bacteria | 9123 |
| 139 | Ga0123357_10300349 | 3300009784 | Bacteria | 1623 |
| 140 | Ga0123355_10059847 | 3300009826 | Bacteria | 6152 |
| 141 | Ga0123355_10738483 | 3300009826 | Bacteria | 1117 |
| 142 | Ga0123356_11131988 | 3300010049 | Bacteria | 950 |
| 143 | Ga0123354_10598894 | 3300010882 | Bacteria | 808 |
| 144 | Ga0466729_212182 | 3300042621 | Bacteria | 4781 |
| 145 | Ga0466704_512294 | 3300042643 | Bacteria | 1758 |
| 146 | Ga0466708_168507 | 3300042652 | Archaea | 4398 |
| 147 | Ga0466727_141161 | 3300042655 | Bacteria | 4922 |
| 148 | Ga0466727_272648 | 3300042655 | Bacteria | 1004 |
| 149 | Ga0466705_413950 | 3300042612 | Bacteria | 12535 |
| 150 | Ga0466705_472559 | 3300042612 | Bacteria | 4667 |
| 151 | Ga0466712_001982 | 3300042614 | Unclassified | 4628 |
| 152 | Ga0466712_034475 | 3300042614 | Unclassified | 14452 |
| 153 | Ga0466712_111262 | 3300042614 | Bacteria | 1070 |
| 154 | Ga0466718_053327 | 3300042617 | Bacteria | 6418 |
| 155 | Ga0466718_106793 | 3300042617 | Unclassified | 1800 |
| 156 | Ga0264413_108276 | 3300024493 | Bacteria | 5642 |
| 157 | Ga0466692_182360 | 3300042591 | Bacteria | 2438 |
| 158 | Ga0466699_121526 | 3300042597 | Unclassified | 1131 |
| 159 | Ga0466699_221684 | 3300042597 | Bacteria | 1429 |
| 160 | AustNasuHG_c1046992 | 3300000089 | Bacteria | 968 |
| 161 | JGI24698J34947_10260821 | 3300002449 | Bacteria | 642 |
| 162 | JGI24695J34938_10000827 | 3300002450 | Bacteria | 28780 |
| 163 | Ga0466700_161384 | 3300042600 | Bacteria | 1249 |
| 164 | Ga0466720_071483 | 3300042607 | Unclassified | 5574 |
| 165 | Ga0123357_10027860 | 3300009784 | Bacteria | 7642 |
| 166 | Ga0123357_10064512 | 3300009784 | Bacteria | 4893 |
| 167 | Ga0123357_10325520 | 3300009784 | Bacteria | 1511 |
| 168 | Ga0123356_10005254 | 3300010049 | Unclassified | 13217 |
| 169 | Ga0123356_10048763 | 3300010049 | Bacteria | 3941 |
| 170 | Ga0123356_10238142 | 3300010049 | Bacteria | 1889 |
| 171 | Ga0123356_11254957 | 3300010049 | Bacteria | 905 |
| 172 | Ga0123356_12141562 | 3300010049 | Bacteria | 698 |
| 173 | Ga0123356_12143178 | 3300010049 | Bacteria | 698 |
| 174 | Ga0123353_10330836 | 3300010167 | Bacteria | 2306 |
| 175 | Ga0123353_11015703 | 3300010167 | Bacteria | 1112 |
| 176 | Ga0466735_156502 | 3300042624 | Bacteria | 1207 |
| 177 | Ga0466712_028592 | 3300042614 | Bacteria | 6294 |
| 178 | Ga0466723_183587 | 3300042618 | Unclassified | 2996 |
| 179 | Ga0466726_034181 | 3300042619 | Bacteria | 2355 |
| 180 | JGI24695J34938_10000579 | 3300002450 | Bacteria | 35323 |
| 181 | JGI24695J34938_10007197 | 3300002450 | Bacteria | 6555 |
| 182 | JGI24695J34938_10056153 | 3300002450 | Bacteria | 1699 |
| 183 | JGI24695J34938_10084609 | 3300002450 | Bacteria | 1307 |
| 184 | JGI24695J34938_10086004 | 3300002450 | Bacteria | 1294 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02452 | PemK_toxin | PemK-like, MazF-like toxin of type II toxin-antitoxin system | 2 | 113 | 0.93 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02452 | GO:0003677 | DNA binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.