Protein Family IF00823
Metagenome
Isolate
119
Members
55
Samples
111
Scaffolds
254.99
Avg Length
Representative Sequence
- ID
- 3300002462|JGI24702J35022_10244080|JGI24702J35022_102440801
- Length
- 282 aa
- Sequence
- MPHQKNATFDPMKDLPNSKKGYNDNTLKAFDRLLHIMDELREKCPWDREQTLESLRPLTIEETYELSDSIVNQDNNGIAKELGDLLLHIVFYAKIGSELQTFTMEDVINKLCDKLIYRHPHVFGTTEVQGSGEVVENWEKLKMTEKDGNKSILSGVPSGLPALIKAYRIQDKARAVGFDWEEREQVWDKVKEELAEFMEAQQQCDALQMEAEFGDLIFSLVNAARLYGINPETALEQTNRKFIKRFNYLEQQTIKKGRSLKEMTLQEMDTIWEDSKIVRAD*
Sample Types
Isolate
6.7%
Metagenome
93.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
38.9%
Kalotermitidae
25.9%
Unclassified
16.7%
Passalidae
5.6%
Termopsidae
5.6%
Rhinotermitidae
3.7%
Hodotermitidae
1.9%
Blattidae
1.9%
Taxonomy
Archaea
0
Bacteria
108
Eukaryota
0
Viruses
0
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 2 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 3 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 4 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 5 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 6 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 7 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 8 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 9 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 10 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 11 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 12 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 13 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 14 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 15 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 16 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 17 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 18 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 19 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 20 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 21 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 22 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 23 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 24 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 25 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 26 | 2820781750 | Unclassified Bacteroidetes Emb289P3bin89 | Isolate | Unclassified |
| 27 | 2820789850 | Unclassified Bacteroidetes Cu122P3bin3 | Isolate | Unclassified |
| 28 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 29 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 30 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 31 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 32 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 33 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 34 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 35 | 2820772500 | Unclassified Bacteroidetes Lab288P1bin72 | Isolate | Unclassified |
| 36 | 2820740053 | Unclassified Bacteroidetes Th196P3bin81 | Isolate | Unclassified |
| 37 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 38 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 39 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 40 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 41 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 42 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 43 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 44 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 45 | 2820767225 | Unclassified Bacteroidetes Lab288P3bin34 | Isolate | Unclassified |
| 46 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 47 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 48 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 49 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 50 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 51 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 52 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 53 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 54 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 55 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466707_396233 | 3300042601 | Bacteria | 4960 |
| 2 | 2227480171 | 2225789004 | Bacteria | 93917 |
| 3 | IMNBL1DRAFT_c0000425 | 3300000062 | Bacteria | 35440 |
| 4 | JGI24702J35022_10244080 | 3300002462 | Bacteria | 1043 |
| 5 | JGI24696J40584_12950550 | 3300002834 | Bacteria | 2159 |
| 6 | Ga0123353_10015747 | 3300010167 | Bacteria | 11010 |
| 7 | Ga0123353_10291554 | 3300010167 | Unclassified | 2497 |
| 8 | Ga0123353_10458897 | 3300010167 | Unclassified | 1873 |
| 9 | Ga0123354_10047505 | 3300010882 | Bacteria | 6542 |
| 10 | Ga0123354_10370818 | 3300010882 | Bacteria | 1249 |
| 11 | Ga0466710_282604 | 3300042613 | Bacteria | 1839 |
| 12 | Ga0466715_029087 | 3300042616 | Bacteria | 29670 |
| 13 | Ga0466723_044999 | 3300042618 | Bacteria | 7097 |
| 14 | Ga0466693_320501 | 3300042592 | Bacteria | 1013 |
| 15 | Ga0466695_397964 | 3300042595 | Bacteria | 8149 |
| 16 | Ga0466725_259368 | 3300042654 | Bacteria | 32926 |
| 17 | Ga0466697_273427 | 3300042611 | Bacteria | 11288 |
| 18 | Ga0466706_019250 | 3300042599 | Bacteria | 3859 |
| 19 | Ga0466707_406019 | 3300042601 | Bacteria | 1371 |
| 20 | 2227136364 | 2225789004 | Bacteria | 36244 |
| 21 | Ga0123353_10699199 | 3300010167 | Bacteria | 1423 |
| 22 | Ga0466715_119391 | 3300042616 | Unclassified | 1136 |
| 23 | Ga0466715_482629 | 3300042616 | Bacteria | 44538 |
| 24 | Ga0466726_221477 | 3300042619 | Bacteria | 6216 |
| 25 | Ga0466728_307994 | 3300042620 | Bacteria | 41396 |
| 26 | Ga0466717_098137 | 3300042604 | Bacteria | 2122 |
| 27 | Ga0466719_284745 | 3300042606 | Bacteria | 1247 |
| 28 | Ga0466697_029770 | 3300042611 | Bacteria | 1381 |
| 29 | 2227619058 | 2225789004 | Bacteria | 45134 |
| 30 | IMNBL1DRAFT_c0008783 | 3300000062 | Bacteria | 5095 |
| 31 | Ga0072940_1226488 | 3300005200 | Bacteria | 2417 |
| 32 | Ga0123356_10083995 | 3300010049 | Bacteria | 3017 |
| 33 | Ga0123353_10101848 | 3300010167 | Bacteria | 4629 |
| 34 | Ga0466710_451486 | 3300042613 | Bacteria | 2407 |
| 35 | Ga0466715_119345 | 3300042616 | Unclassified | 1503 |
| 36 | Ga0466696_035634 | 3300042596 | Bacteria | 1323 |
| 37 | Ga0466731_192666 | 3300042622 | Bacteria | 1358 |
| 38 | Ga0466735_139002 | 3300042624 | Bacteria | 1489 |
| 39 | Ga0466703_100935 | 3300042636 | Bacteria | 13355 |
| 40 | Ga0466704_060132 | 3300042643 | Bacteria | 107799 |
| 41 | Ga0466697_210977 | 3300042611 | Bacteria | 1398 |
| 42 | Ga0466714_025033 | 3300042603 | Bacteria | 3817 |
| 43 | Ga0466716_374612 | 3300042605 | Bacteria | 31117 |
| 44 | Ga0466698_336464 | 3300042610 | Bacteria | 1821 |
| 45 | JGI24705J35276_12138682 | 3300002504 | Bacteria | 1132 |
| 46 | JGI24705J35276_12155214 | 3300002504 | Bacteria | 1203 |
| 47 | Ga0068305_10339467 | 3300005083 | Bacteria | 2604 |
| 48 | Ga0123356_10818136 | 3300010049 | Bacteria | 1103 |
| 49 | Ga0123353_10219771 | 3300010167 | Bacteria | 2972 |
| 50 | Ga0123353_10316324 | 3300010167 | Bacteria | 2372 |
| 51 | Ga0123353_10400456 | 3300010167 | Bacteria | 2043 |
| 52 | Ga0123353_10774236 | 3300010167 | Unclassified | 1331 |
| 53 | Ga0123354_10381266 | 3300010882 | Bacteria | 1217 |
| 54 | Ga0466728_030222 | 3300042620 | Bacteria | 9268 |
| 55 | Ga0466691_077111 | 3300042593 | Bacteria | 14079 |
| 56 | Ga0466735_176136 | 3300042624 | Bacteria | 1701 |
| 57 | Ga0466703_016768 | 3300042636 | Bacteria | 8278 |
| 58 | Ga0466704_244812 | 3300042643 | Bacteria | 49194 |
| 59 | Ga0466708_389661 | 3300042652 | Unclassified | 2896 |
| 60 | Ga0466705_224259 | 3300042612 | Bacteria | 11325 |
| 61 | Ga0466707_271885 | 3300042601 | Bacteria | 4851 |
| 62 | Ga0466719_443461 | 3300042606 | Bacteria | 2013 |
| 63 | JGI24702J35022_10009988 | 3300002462 | Bacteria | 5318 |
| 64 | Ga0123356_10266282 | 3300010049 | Bacteria | 1801 |
| 65 | Ga0123353_10022475 | 3300010167 | Bacteria | 9512 |
| 66 | Ga0466711_186024 | 3300042615 | Bacteria | 17708 |
| 67 | Ga0466715_418746 | 3300042616 | Bacteria | 64063 |
| 68 | Ga0466690_196912 | 3300042590 | Bacteria | 20732 |
| 69 | Ga0466709_005952 | 3300042648 | Bacteria | 2263 |
| 70 | Ga0466733_113897 | 3300042659 | Bacteria | 7146 |
| 71 | Ga0466714_028666 | 3300042603 | Bacteria | 89946 |
| 72 | Ga0466716_089390 | 3300042605 | Bacteria | 3030 |
| 73 | Ga0466721_038515 | 3300042608 | Bacteria | 23451 |
| 74 | Ga0466722_059383 | 3300042609 | Bacteria | 11770 |
| 75 | IMNBL1DRAFT_c0000077 | 3300000062 | Bacteria | 88150 |
| 76 | JGI24705J35276_12082743 | 3300002504 | Bacteria | 977 |
| 77 | JGI24705J35276_12204419 | 3300002504 | Bacteria | 1676 |
| 78 | Ga0072941_1110369 | 3300005201 | Bacteria | 4256 |
| 79 | Ga0123356_10008315 | 3300010049 | Unclassified | 10326 |
| 80 | Ga0123356_10543789 | 3300010049 | Bacteria | 1322 |
| 81 | Ga0123356_11142694 | 3300010049 | Bacteria | 946 |
| 82 | Ga0123354_10300225 | 3300010882 | Bacteria | 1520 |
| 83 | Ga0466728_336992 | 3300042620 | Unclassified | 3773 |
| 84 | Ga0466691_040831 | 3300042593 | Bacteria | 126917 |
| 85 | Ga0466703_191697 | 3300042636 | Unclassified | 1758 |
| 86 | Ga0466705_298511 | 3300042612 | Bacteria | 17942 |
| 87 | Ga0466732_043598 | 3300042656 | Bacteria | 56649 |
| 88 | Ga0466733_184148 | 3300042659 | Bacteria | 2400 |
| 89 | Ga0466701_050462 | 3300042598 | Bacteria | 9942 |
| 90 | Ga0466700_382753 | 3300042600 | Bacteria | 1897 |
| 91 | Ga0466713_047975 | 3300042602 | Bacteria | 7761 |
| 92 | 2226980363 | 2225789003 | Bacteria | 39299 |
| 93 | JGI24702J35022_10050847 | 3300002462 | Bacteria | 2208 |
| 94 | JGI24702J35022_10070151 | 3300002462 | Bacteria | 1886 |
| 95 | Ga0123353_10017869 | 3300010167 | Bacteria | 10454 |
| 96 | Ga0123353_10759100 | 3300010167 | Bacteria | 1348 |
| 97 | Ga0123353_10817500 | 3300010167 | Bacteria | 1284 |
| 98 | Ga0466711_039781 | 3300042615 | Bacteria | 1796 |
| 99 | Ga0466729_046348 | 3300042621 | Bacteria | 15815 |
| 100 | Ga0466727_042687 | 3300042655 | Bacteria | 90775 |
| 101 | Ga0466697_127746 | 3300042611 | Bacteria | 1938 |
| 102 | Ga0466733_122879 | 3300042659 | Bacteria | 11260 |
| 103 | Ga0466716_212557 | 3300042605 | Unclassified | 1670 |
| 104 | JGI24702J35022_10006123 | 3300002462 | Unclassified | 6980 |
| 105 | Ga0123353_10208765 | 3300010167 | Bacteria | 3065 |
| 106 | Ga0123353_10458236 | 3300010167 | Bacteria | 1875 |
| 107 | Ga0466691_005377 | 3300042593 | Bacteria | 2852 |
| 108 | Ga0466735_111032 | 3300042624 | Bacteria | 1048 |
| 109 | Ga0466704_565577 | 3300042643 | Bacteria | 39753 |
| 110 | Ga0466709_274177 | 3300042648 | Bacteria | 1759 |
| 111 | Ga0466727_067759 | 3300042655 | Bacteria | 6479 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.