Protein Family IF00816
Metagenome
Isolate
130
Members
46
Samples
119
Scaffolds
153.62
Avg Length
Representative Sequence
- ID
- 3300002462|JGI24702J35022_10104986|JGI24702J35022_101049863
- Length
- 184 aa
- Sequence
- MGMIKNSVDDEKSHVIKKLYICTRKNSFMKQRIYIDTSVVGGYHDKEFEAYTVPLFXRIRNGEFTVLVSTATQDELENAPVHVQDLIKNMKNDYTEFLTISDEAVELANAYISEKVVGQTCYTDCLHIALATIHRADFLISWNFKHIVNVRRIMGYNSINIRNGYKQLEIRSPRDFEKYEDNE*
Sample Types
Isolate
6.9%
Metagenome
93.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
63.6%
Kalotermitidae
15.9%
Unclassified
9.1%
Termopsidae
6.8%
Passalidae
4.5%
Taxonomy
Archaea
0
Bacteria
102
Eukaryota
0
Viruses
0
Unclassified
28
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 2 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 3 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 4 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 5 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 6 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 7 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 8 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 9 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 10 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 11 | 2228664001 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4a from Florida USA | Metagenome | Termitidae |
| 12 | 2778260940 | Unclassified Fibrobacteres Mp193P3bin36 | Isolate | Unclassified |
| 13 | 2778260941 | Unclassified Fibrobacteres Th196P3bin8 | Isolate | Unclassified |
| 14 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 15 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 16 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 17 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 18 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 19 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 20 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 21 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 22 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 23 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 24 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 25 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 26 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 27 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 28 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 29 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 30 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 31 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 32 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 33 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 34 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 35 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 36 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 37 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 38 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 39 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 40 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 41 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 42 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 43 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 44 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 45 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 46 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_455512 | 3300042612 | Unclassified | 2441 |
| 2 | Ga0466712_045410 | 3300042614 | Bacteria | 1155 |
| 3 | Ga0466711_377756 | 3300042615 | Unclassified | 3967 |
| 4 | Ga0466728_211310 | 3300042620 | Bacteria | 3603 |
| 5 | 2230930372 | 2228664001 | Bacteria | 1584 |
| 6 | JGI24698J34947_10008683 | 3300002449 | Unclassified | 5573 |
| 7 | JGI24698J34947_10029795 | 3300002449 | Bacteria | 2881 |
| 8 | JGI24702J35022_10104986 | 3300002462 | Bacteria | 1550 |
| 9 | Ga0072941_1003920 | 3300005201 | Bacteria | 88957 |
| 10 | Ga0123354_10401934 | 3300010882 | Unclassified | 1158 |
| 11 | Ga0466727_093203 | 3300042655 | Unclassified | 1936 |
| 12 | Ga0264413_126387 | 3300024493 | Unclassified | 1543 |
| 13 | Ga0466705_438722 | 3300042612 | Bacteria | 5436 |
| 14 | Ga0466711_152222 | 3300042615 | Bacteria | 1122 |
| 15 | Ga0466726_087747 | 3300042619 | Bacteria | 4063 |
| 16 | Ga0466721_274835 | 3300042608 | Bacteria | 1184 |
| 17 | Ga0466721_359318 | 3300042608 | Bacteria | 1317 |
| 18 | Ga0466698_134235 | 3300042610 | Bacteria | 3052 |
| 19 | IMNBL1DRAFT_c0028560 | 3300000062 | Bacteria | 2079 |
| 20 | JGI24698J34947_10000065 | 3300002449 | Bacteria | 32991 |
| 21 | JGI24698J34947_10105414 | 3300002449 | Bacteria | 1257 |
| 22 | JGI24698J34947_10216863 | 3300002449 | Unclassified | 737 |
| 23 | Ga0123353_10875868 | 3300010167 | Bacteria | 1226 |
| 24 | Ga0466697_228638 | 3300042611 | Bacteria | 1357 |
| 25 | Ga0466693_083472 | 3300042592 | Bacteria | 1678 |
| 26 | Ga0466712_024869 | 3300042614 | Unclassified | 3421 |
| 27 | Ga0466712_102777 | 3300042614 | Bacteria | 2469 |
| 28 | Ga0466712_281347 | 3300042614 | Unclassified | 8619 |
| 29 | Ga0466711_167360 | 3300042615 | Bacteria | 3975 |
| 30 | 2227504055 | 2225789004 | Bacteria | 728 |
| 31 | 2227504305 | 2225789004 | Bacteria | 727 |
| 32 | IMNBL1DRAFT_c0010214 | 3300000062 | Bacteria | 4531 |
| 33 | JGI24698J34947_10000012 | 3300002449 | Bacteria | 44757 |
| 34 | JGI24695J34938_10013646 | 3300002450 | Unclassified | 4255 |
| 35 | JGI24697J35500_11067913 | 3300002507 | Unclassified | 1078 |
| 36 | JGI24696J40584_12854099 | 3300002834 | Bacteria | 990 |
| 37 | Ga0123357_10308030 | 3300009784 | Bacteria | 1587 |
| 38 | Ga0123356_10078434 | 3300010049 | Bacteria | 3118 |
| 39 | Ga0123356_10452552 | 3300010049 | Bacteria | 1432 |
| 40 | Ga0123353_11100102 | 3300010167 | Bacteria | 1055 |
| 41 | Ga0123353_11398062 | 3300010167 | Bacteria | 900 |
| 42 | Ga0123354_10193917 | 3300010882 | Bacteria | 2262 |
| 43 | Ga0123354_10730642 | 3300010882 | Unclassified | 683 |
| 44 | Ga0466703_171644 | 3300042636 | Bacteria | 1603 |
| 45 | Ga0466694_321378 | 3300042594 | Bacteria | 1238 |
| 46 | Ga0466732_399552 | 3300042656 | Bacteria | 5256 |
| 47 | Ga0466712_150007 | 3300042614 | Bacteria | 2064 |
| 48 | Ga0466712_307171 | 3300042614 | Bacteria | 2852 |
| 49 | Ga0466716_154221 | 3300042605 | Bacteria | 6471 |
| 50 | Ga0466716_358029 | 3300042605 | Bacteria | 1215 |
| 51 | IMNBL1DRAFT_c0000614 | 3300000062 | Bacteria | 28589 |
| 52 | Ga0123353_10346308 | 3300010167 | Bacteria | 2242 |
| 53 | Ga0466734_112880 | 3300042623 | Bacteria | 1644 |
| 54 | Ga0466735_087392 | 3300042624 | Bacteria | 2302 |
| 55 | Ga0466656_247783 | 3300042550 | Bacteria | 19679 |
| 56 | Ga0466694_109890 | 3300042594 | Bacteria | 7817 |
| 57 | Ga0466712_042447 | 3300042614 | Bacteria | 4283 |
| 58 | Ga0466712_100992 | 3300042614 | Unclassified | 1003 |
| 59 | Ga0466712_154254 | 3300042614 | Unclassified | 2751 |
| 60 | Ga0466718_151350 | 3300042617 | Bacteria | 1125 |
| 61 | Ga0466700_088313 | 3300042600 | Bacteria | 1171 |
| 62 | Ga0466720_081206 | 3300042607 | Bacteria | 3328 |
| 63 | Ga0466720_145062 | 3300042607 | Bacteria | 9079 |
| 64 | Ga0466698_516418 | 3300042610 | Bacteria | 32101 |
| 65 | JGI24695J34938_10009498 | 3300002450 | Unclassified | 5405 |
| 66 | Ga0072941_1013782 | 3300005201 | Bacteria | 31248 |
| 67 | Ga0072941_1195049 | 3300005201 | Bacteria | 791 |
| 68 | Ga0123353_10759621 | 3300010167 | Unclassified | 1348 |
| 69 | Ga0123353_11065690 | 3300010167 | Unclassified | 1078 |
| 70 | Ga0466705_181506 | 3300042612 | Bacteria | 15689 |
| 71 | Ga0466725_085557 | 3300042654 | Bacteria | 2058 |
| 72 | Ga0466690_060707 | 3300042590 | Unclassified | 4852 |
| 73 | Ga0466693_361449 | 3300042592 | Bacteria | 1334 |
| 74 | Ga0466694_182853 | 3300042594 | Bacteria | 1007 |
| 75 | Ga0466695_168861 | 3300042595 | Bacteria | 1204 |
| 76 | Ga0466695_311993 | 3300042595 | Bacteria | 1659 |
| 77 | Ga0466701_011740 | 3300042598 | Bacteria | 1591 |
| 78 | Ga0466712_114363 | 3300042614 | Bacteria | 2954 |
| 79 | Ga0466712_237101 | 3300042614 | Bacteria | 1473 |
| 80 | Ga0466726_087255 | 3300042619 | Bacteria | 4691 |
| 81 | Ga0466728_124884 | 3300042620 | Bacteria | 1161 |
| 82 | Ga0466707_012043 | 3300042601 | Bacteria | 1131 |
| 83 | Ga0466707_320951 | 3300042601 | Bacteria | 1134 |
| 84 | Ga0466719_122712 | 3300042606 | Bacteria | 1118 |
| 85 | IMNBL1DRAFT_c0017894 | 3300000062 | Unclassified | 2963 |
| 86 | Ga0072940_1053614 | 3300005200 | Bacteria | 1651 |
| 87 | Ga0072941_1030633 | 3300005201 | Bacteria | 6742 |
| 88 | Ga0123356_10323116 | 3300010049 | Bacteria | 1657 |
| 89 | Ga0123356_11107420 | 3300010049 | Bacteria | 960 |
| 90 | Ga0466731_007765 | 3300042622 | Unclassified | 1121 |
| 91 | Ga0466702_308382 | 3300042635 | Bacteria | 1150 |
| 92 | Ga0264413_137758 | 3300024493 | Bacteria | 1646 |
| 93 | Ga0466720_075571 | 3300042607 | Unclassified | 1275 |
| 94 | Ga0466720_177857 | 3300042607 | Bacteria | 1078 |
| 95 | JGI24698J34947_10210683 | 3300002449 | Unclassified | 753 |
| 96 | JGI24695J34938_10016292 | 3300002450 | Bacteria | 3784 |
| 97 | JGI24696J40584_12950239 | 3300002834 | Unclassified | 2136 |
| 98 | Ga0068305_10142991 | 3300005083 | Bacteria | 684 |
| 99 | Ga0072941_1082738 | 3300005201 | Bacteria | 9712 |
| 100 | Ga0072941_1126779 | 3300005201 | Bacteria | 7856 |
| 101 | Ga0466731_008987 | 3300042622 | Unclassified | 1655 |
| 102 | Ga0466656_082656 | 3300042550 | Bacteria | 1023 |
| 103 | Ga0466712_189473 | 3300042614 | Unclassified | 4602 |
| 104 | Ga0466718_036071 | 3300042617 | Bacteria | 9026 |
| 105 | Ga0466718_109643 | 3300042617 | Bacteria | 2018 |
| 106 | Ga0466719_202889 | 3300042606 | Bacteria | 1173 |
| 107 | Ga0466721_141857 | 3300042608 | Bacteria | 1049 |
| 108 | 2227393064 | 2225789004 | Bacteria | 1083 |
| 109 | IMNBL1DRAFT_c0161713 | 3300000062 | Bacteria | 571 |
| 110 | JGI24698J34947_10011266 | 3300002449 | Bacteria | 4910 |
| 111 | JGI24698J34947_10069506 | 3300002449 | Unclassified | 1698 |
| 112 | JGI24698J34947_10285167 | 3300002449 | Unclassified | 602 |
| 113 | Ga0123356_10731028 | 3300010049 | Bacteria | 1159 |
| 114 | Ga0123353_11196116 | 3300010167 | Bacteria | 998 |
| 115 | Ga0123354_10444379 | 3300010882 | Bacteria | 1056 |
| 116 | Ga0466702_132189 | 3300042635 | Unclassified | 1018 |
| 117 | Ga0466703_064105 | 3300042636 | Bacteria | 1372 |
| 118 | Ga0264413_112006 | 3300024493 | Bacteria | 24699 |
| 119 | Ga0466693_174748 | 3300042592 | Bacteria | 1004 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.