Protein Family IF00809
Metagenome
Isolate
204
Members
53
Samples
186
Scaffolds
331.62
Avg Length
Representative Sequence
- ID
- 3300002462|JGI24702J35022_10052850|JGI24702J35022_100528502
- Length
- 352 aa
- Sequence
- MSEKSCCPDNSGSVPVVSTKLSFQDYLGAWKARFGIGRMDYTVEAGLYAVGKPDGESPVLVSANYKLTFDTLRKNLDGLDCWLLILDTKGINVWCAAGKGTFGTDELVNRINASELSKHISHKKLILPQLGAAGVSAHEVKSRSGYEVKYGPVRAEDIKAYIEAGYEATKEMRTVKFTLWDRLVLTPMELLPALKIALPIMGVMLLSNKFMAKPFDKSDYAALAGAVAGGTVVTPALLPAIPGKAFSLKGWLVGLGGTAAILGLTGKFSGKSKEKNHLLSAGHLLLFPALSSYLAMNFTGASTYTSPSGVNKEMKKALPFIVGAASVGAALTLGAHLFGRGKREKKGGQQK*
Sample Types
Isolate
8.8%
Metagenome
91.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
53.8%
Unclassified
34.6%
Kalotermitidae
9.6%
Rhinotermitidae
1.9%
Taxonomy
Archaea
7
Bacteria
187
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820353569 | Unclassified Firmicutes Nt197P3bin28 | Isolate | Unclassified |
| 2 | 2820364642 | Unclassified Firmicutes Nt197P3bin107 | Isolate | Unclassified |
| 3 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 4 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 5 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 6 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 7 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 8 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 9 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 10 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 11 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 12 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 13 | 2820495292 | Unclassified Firmicutes Lab288P1bin59 | Isolate | Unclassified |
| 14 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 15 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 16 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 17 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 18 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 19 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 20 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 21 | 2820010479 | Unclassified Spirochaetes Th196P4bin55 | Isolate | Unclassified |
| 22 | 2820551407 | Unclassified Firmicutes Emb289P4bin38 | Isolate | Unclassified |
| 23 | 2820683647 | Unclassified Firmicutes Co191P1bin82 | Isolate | Unclassified |
| 24 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 25 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 26 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 27 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 28 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 29 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 30 | 2820312173 | Unclassified Firmicutes Nt197P4bin8 | Isolate | Unclassified |
| 31 | 2820450073 | Unclassified Firmicutes Lab288P3bin186 | Isolate | Unclassified |
| 32 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 33 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 34 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 35 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 36 | 2820008971 | Unclassified Synergistetes Lab288P3bin103 | Isolate | Unclassified |
| 37 | 2820201435 | Unclassified Planctomycetes Cu122P5bin25 | Isolate | Unclassified |
| 38 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 39 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 40 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 41 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 42 | 2820344559 | Unclassified Firmicutes Nt197P3bin63 | Isolate | Unclassified |
| 43 | 2820576413 | Unclassified Firmicutes Emb289P3bin136 | Isolate | Unclassified |
| 44 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 45 | 2820089333 | Unclassified Proteobacteria Lab288P3bin88 | Isolate | Unclassified |
| 46 | 2820324456 | Unclassified Firmicutes Nt197P3bin80 | Isolate | Unclassified |
| 47 | 2820427814 | Unclassified Firmicutes Lab288P3bin44 | Isolate | Unclassified |
| 48 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 49 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 50 | 2820292184 | Unclassified Firmicutes Th196P3bin109 | Isolate | Unclassified |
| 51 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 52 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 53 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_105533 | 3300042611 | Bacteria | 1075 |
| 2 | Ga0123357_10038039 | 3300009784 | Bacteria | 6551 |
| 3 | Ga0123356_10014566 | 3300010049 | Archaea | 7559 |
| 4 | Ga0123356_10020157 | 3300010049 | Bacteria | 6313 |
| 5 | Ga0123353_10047396 | 3300010167 | Bacteria | 6834 |
| 6 | Ga0123353_10055761 | 3300010167 | Bacteria | 6323 |
| 7 | Ga0123353_10085907 | 3300010167 | Bacteria | 5067 |
| 8 | Ga0123353_10093300 | 3300010167 | Bacteria | 4850 |
| 9 | Ga0123353_10126759 | 3300010167 | Bacteria | 4102 |
| 10 | Ga0123353_10136533 | 3300010167 | Bacteria | 3933 |
| 11 | Ga0123353_10336794 | 3300010167 | Bacteria | 2281 |
| 12 | Ga0123353_10392970 | 3300010167 | Bacteria | 2068 |
| 13 | Ga0123353_10449184 | 3300010167 | Bacteria | 1898 |
| 14 | Ga0123353_10616653 | 3300010167 | Bacteria | 1546 |
| 15 | Ga0123353_10683841 | 3300010167 | Bacteria | 1444 |
| 16 | Ga0123354_10017790 | 3300010882 | Bacteria | 11136 |
| 17 | Ga0466694_305074 | 3300042594 | Bacteria | 2433 |
| 18 | Ga0466695_172583 | 3300042595 | Bacteria | 5937 |
| 19 | Ga0466700_135765 | 3300042600 | Unclassified | 1027 |
| 20 | Ga0466717_281017 | 3300042604 | Bacteria | 2365 |
| 21 | Ga0466721_109281 | 3300042608 | Bacteria | 3853 |
| 22 | JGI24702J35022_10000798 | 3300002462 | Bacteria | 19487 |
| 23 | JGI24702J35022_10006033 | 3300002462 | Bacteria | 7032 |
| 24 | Ga0466697_088290 | 3300042611 | Bacteria | 1372 |
| 25 | Ga0123353_10008392 | 3300010167 | Bacteria | 14100 |
| 26 | Ga0123353_10053250 | 3300010167 | Bacteria | 6468 |
| 27 | Ga0123353_10100123 | 3300010167 | Bacteria | 4671 |
| 28 | Ga0123353_10251857 | 3300010167 | Unclassified | 2734 |
| 29 | Ga0123353_10365368 | 3300010167 | Bacteria | 2167 |
| 30 | Ga0123353_10676884 | 3300010167 | Bacteria | 1454 |
| 31 | Ga0123354_10084537 | 3300010882 | Unclassified | 4455 |
| 32 | Ga0123354_10246396 | 3300010882 | Bacteria | 1823 |
| 33 | Ga0466656_318789 | 3300042550 | Bacteria | 2405 |
| 34 | Ga0466731_369936 | 3300042622 | Bacteria | 4266 |
| 35 | Ga0466702_236840 | 3300042635 | Bacteria | 3780 |
| 36 | Ga0466721_243106 | 3300042608 | Bacteria | 3176 |
| 37 | Ga0466721_304180 | 3300042608 | Bacteria | 1304 |
| 38 | Ga0466697_007979 | 3300042611 | Bacteria | 5037 |
| 39 | JGI24702J35022_10023241 | 3300002462 | Bacteria | 3352 |
| 40 | JGI24702J35022_10043213 | 3300002462 | Bacteria | 2400 |
| 41 | Ga0466711_293883 | 3300042615 | Bacteria | 1637 |
| 42 | Ga0123355_10221981 | 3300009826 | Bacteria | 2715 |
| 43 | Ga0123356_10008297 | 3300010049 | Bacteria | 10334 |
| 44 | Ga0123356_10064889 | 3300010049 | Bacteria | 3415 |
| 45 | Ga0123356_10496061 | 3300010049 | Bacteria | 1376 |
| 46 | Ga0123356_10755948 | 3300010049 | Unclassified | 1142 |
| 47 | Ga0123353_10097081 | 3300010167 | Bacteria | 4749 |
| 48 | Ga0123353_10114841 | 3300010167 | Bacteria | 4334 |
| 49 | Ga0123353_10175558 | 3300010167 | Bacteria | 3397 |
| 50 | Ga0123353_10371528 | 3300010167 | Bacteria | 2144 |
| 51 | Ga0123353_10543285 | 3300010167 | Bacteria | 1678 |
| 52 | Ga0123353_10565593 | 3300010167 | Bacteria | 1636 |
| 53 | Ga0123354_10108178 | 3300010882 | Unclassified | 3695 |
| 54 | Ga0123354_10259948 | 3300010882 | Bacteria | 1736 |
| 55 | Ga0415639_016750 | 3300038395 | Bacteria | 7886 |
| 56 | Ga0415639_146575 | 3300038395 | Bacteria | 1578 |
| 57 | Ga0466693_070775 | 3300042592 | Unclassified | 2492 |
| 58 | Ga0466695_212809 | 3300042595 | Bacteria | 1009 |
| 59 | Ga0466696_110297 | 3300042596 | Bacteria | 7776 |
| 60 | Ga0466731_291562 | 3300042622 | Bacteria | 2131 |
| 61 | Ga0466725_154471 | 3300042654 | Bacteria | 2048 |
| 62 | Ga0466725_247738 | 3300042654 | Bacteria | 1605 |
| 63 | Ga0466700_026159 | 3300042600 | Bacteria | 1601 |
| 64 | Ga0466700_273855 | 3300042600 | Bacteria | 1333 |
| 65 | JGI24695J34938_10003057 | 3300002450 | Bacteria | 11983 |
| 66 | JGI24702J35022_10026496 | 3300002462 | Bacteria | 3122 |
| 67 | JGI24702J35022_10032476 | 3300002462 | Bacteria | 2795 |
| 68 | Ga0123355_10003230 | 3300009826 | Bacteria | 23286 |
| 69 | Ga0123355_10077889 | 3300009826 | Bacteria | 5298 |
| 70 | Ga0123356_10017668 | 3300010049 | Bacteria | 6781 |
| 71 | Ga0123356_10113135 | 3300010049 | Archaea | 2625 |
| 72 | Ga0123356_10169377 | 3300010049 | Bacteria | 2193 |
| 73 | Ga0123356_10280873 | 3300010049 | Bacteria | 1760 |
| 74 | Ga0123356_10339118 | 3300010049 | Bacteria | 1623 |
| 75 | Ga0123356_10781485 | 3300010049 | Bacteria | 1126 |
| 76 | Ga0123353_10071934 | 3300010167 | Bacteria | 5558 |
| 77 | Ga0123353_10139546 | 3300010167 | Bacteria | 3884 |
| 78 | Ga0123353_10207982 | 3300010167 | Bacteria | 3071 |
| 79 | Ga0123353_10261922 | 3300010167 | Bacteria | 2670 |
| 80 | Ga0123353_10264130 | 3300010167 | Bacteria | 2656 |
| 81 | Ga0123353_10353444 | 3300010167 | Bacteria | 2213 |
| 82 | Ga0123353_10413572 | 3300010167 | Bacteria | 2001 |
| 83 | Ga0123353_10811630 | 3300010167 | Bacteria | 1290 |
| 84 | Ga0123354_10213251 | 3300010882 | Unclassified | 2078 |
| 85 | Ga0415639_002733 | 3300038395 | Bacteria | 94318 |
| 86 | Ga0466693_272890 | 3300042592 | Bacteria | 1726 |
| 87 | Ga0466694_016896 | 3300042594 | Bacteria | 1941 |
| 88 | Ga0466731_179456 | 3300042622 | Unclassified | 5127 |
| 89 | Ga0466731_289748 | 3300042622 | Bacteria | 5597 |
| 90 | Ga0466734_136032 | 3300042623 | Bacteria | 1493 |
| 91 | Ga0466702_112574 | 3300042635 | Bacteria | 4791 |
| 92 | JGI24702J35022_10020503 | 3300002462 | Bacteria | 3587 |
| 93 | JGI24702J35022_10052850 | 3300002462 | Bacteria | 2166 |
| 94 | JGI24702J35022_10167933 | 3300002462 | Bacteria | 1240 |
| 95 | JGI24705J35276_12237169 | 3300002504 | Bacteria | 10055 |
| 96 | Ga0072941_1049484 | 3300005201 | Bacteria | 3643 |
| 97 | Ga0466732_110191 | 3300042656 | Bacteria | 2722 |
| 98 | Ga0123356_10013375 | 3300010049 | Bacteria | 7926 |
| 99 | Ga0123356_10040339 | 3300010049 | Bacteria | 4350 |
| 100 | Ga0123356_10132474 | 3300010049 | Bacteria | 2445 |
| 101 | Ga0123353_10085770 | 3300010167 | Bacteria | 5071 |
| 102 | Ga0123353_10093405 | 3300010167 | Archaea | 4847 |
| 103 | Ga0123353_10108204 | 3300010167 | Archaea | 4480 |
| 104 | Ga0123353_10740800 | 3300010167 | Bacteria | 1370 |
| 105 | Ga0123354_10064030 | 3300010882 | Unclassified | 5396 |
| 106 | Ga0415639_074656 | 3300038395 | Bacteria | 1364 |
| 107 | Ga0466691_087496 | 3300042593 | Bacteria | 4602 |
| 108 | Ga0466701_038158 | 3300042598 | Bacteria | 1431 |
| 109 | Ga0466700_128067 | 3300042600 | Bacteria | 3147 |
| 110 | Ga0466721_152994 | 3300042608 | Bacteria | 1806 |
| 111 | Ga0466722_023476 | 3300042609 | Bacteria | 38785 |
| 112 | Ga0466698_081392 | 3300042610 | Bacteria | 2762 |
| 113 | AustNasuHG_c1002365 | 3300000089 | Bacteria | 6820 |
| 114 | JGI24702J35022_10036386 | 3300002462 | Bacteria | 2631 |
| 115 | JGI24705J35276_12236730 | 3300002504 | Unclassified | 8773 |
| 116 | JGI24696J40584_12935696 | 3300002834 | Bacteria | 1565 |
| 117 | Ga0072940_1310371 | 3300005200 | Bacteria | 1532 |
| 118 | Ga0466710_072470 | 3300042613 | Bacteria | 3646 |
| 119 | Ga0123357_10007602 | 3300009784 | Bacteria | 13419 |
| 120 | Ga0123357_10024126 | 3300009784 | Bacteria | 8183 |
| 121 | Ga0123357_10206834 | 3300009784 | Bacteria | 2217 |
| 122 | Ga0123356_10055221 | 3300010049 | Bacteria | 3700 |
| 123 | Ga0123356_10097352 | 3300010049 | Bacteria | 2815 |
| 124 | Ga0123356_10286313 | 3300010049 | Bacteria | 1746 |
| 125 | Ga0123353_10003548 | 3300010167 | Bacteria | 19751 |
| 126 | Ga0123353_10005577 | 3300010167 | Bacteria | 16553 |
| 127 | Ga0123353_10007060 | 3300010167 | Bacteria | 15109 |
| 128 | Ga0123353_10065470 | 3300010167 | Archaea | 5834 |
| 129 | Ga0123353_10096340 | 3300010167 | Bacteria | 4768 |
| 130 | Ga0123353_10177126 | 3300010167 | Bacteria | 3380 |
| 131 | Ga0123353_10227373 | 3300010167 | Bacteria | 2912 |
| 132 | Ga0123353_10229265 | 3300010167 | Bacteria | 2898 |
| 133 | Ga0123353_10239145 | 3300010167 | Bacteria | 2823 |
| 134 | Ga0123353_10626640 | 3300010167 | Bacteria | 1529 |
| 135 | Ga0123353_10658994 | 3300010167 | Bacteria | 1480 |
| 136 | Ga0123354_10355413 | 3300010882 | Bacteria | 1300 |
| 137 | Ga0415639_003811 | 3300038395 | Bacteria | 11131 |
| 138 | Ga0415639_171279 | 3300038395 | Bacteria | 2013 |
| 139 | Ga0466693_304789 | 3300042592 | Archaea | 2043 |
| 140 | Ga0466709_102896 | 3300042648 | Bacteria | 2644 |
| 141 | Ga0466707_386805 | 3300042601 | Bacteria | 1636 |
| 142 | Ga0466717_089970 | 3300042604 | Bacteria | 1091 |
| 143 | JGI24702J35022_10007644 | 3300002462 | Bacteria | 6178 |
| 144 | Ga0466697_214744 | 3300042611 | Bacteria | 1103 |
| 145 | Ga0123356_10043168 | 3300010049 | Bacteria | 4198 |
| 146 | Ga0123356_10057588 | 3300010049 | Bacteria | 3623 |
| 147 | Ga0123356_10135407 | 3300010049 | Bacteria | 2421 |
| 148 | Ga0123356_10150809 | 3300010049 | Bacteria | 2307 |
| 149 | Ga0123356_10151980 | 3300010049 | Bacteria | 2299 |
| 150 | Ga0123353_10043727 | 3300010167 | Bacteria | 7097 |
| 151 | Ga0415639_031216 | 3300038395 | Bacteria | 2255 |
| 152 | Ga0415639_044291 | 3300038395 | Bacteria | 4181 |
| 153 | Ga0415639_061603 | 3300038395 | Bacteria | 7897 |
| 154 | Ga0466694_350335 | 3300042594 | Bacteria | 2819 |
| 155 | Ga0466695_183814 | 3300042595 | Bacteria | 1496 |
| 156 | Ga0466695_340707 | 3300042595 | Bacteria | 2262 |
| 157 | JGI24702J35022_10002040 | 3300002462 | Bacteria | 12445 |
| 158 | JGI24702J35022_10025158 | 3300002462 | Bacteria | 3214 |
| 159 | Ga0466715_185970 | 3300042616 | Bacteria | 24040 |
| 160 | Ga0123357_10113939 | 3300009784 | Bacteria | 3434 |
| 161 | Ga0123357_10139475 | 3300009784 | Bacteria | 2985 |
| 162 | Ga0123355_10017809 | 3300009826 | Bacteria | 11237 |
| 163 | Ga0123355_10065760 | 3300009826 | Bacteria | 5839 |
| 164 | Ga0123355_10303282 | 3300009826 | Bacteria | 2174 |
| 165 | Ga0123356_10005097 | 3300010049 | Bacteria | 13463 |
| 166 | Ga0123356_10617977 | 3300010049 | Bacteria | 1249 |
| 167 | Ga0123353_10008987 | 3300010167 | Bacteria | 13726 |
| 168 | Ga0123353_10048429 | 3300010167 | Bacteria | 6767 |
| 169 | Ga0123353_10136708 | 3300010167 | Bacteria | 3930 |
| 170 | Ga0123353_10225843 | 3300010167 | Bacteria | 2923 |
| 171 | Ga0123353_10365320 | 3300010167 | Bacteria | 2167 |
| 172 | Ga0123353_10522583 | 3300010167 | Bacteria | 1721 |
| 173 | Ga0123353_10594643 | 3300010167 | Bacteria | 1583 |
| 174 | Ga0466694_050232 | 3300042594 | Bacteria | 2411 |
| 175 | Ga0466694_384214 | 3300042594 | Bacteria | 2201 |
| 176 | Ga0466734_080305 | 3300042623 | Archaea | 1437 |
| 177 | Ga0466725_119812 | 3300042654 | Bacteria | 1354 |
| 178 | Ga0466725_128790 | 3300042654 | Bacteria | 1048 |
| 179 | Ga0466700_472914 | 3300042600 | Bacteria | 2507 |
| 180 | Ga0466717_035220 | 3300042604 | Bacteria | 30821 |
| 181 | Ga0466717_184955 | 3300042604 | Bacteria | 1681 |
| 182 | Ga0466721_205152 | 3300042608 | Bacteria | 1079 |
| 183 | Ga0466698_455149 | 3300042610 | Bacteria | 4698 |
| 184 | JGI24702J35022_10009597 | 3300002462 | Bacteria | 5425 |
| 185 | JGI24702J35022_10024159 | 3300002462 | Bacteria | 3283 |
| 186 | JGI24702J35022_10060729 | 3300002462 | Bacteria | 2021 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF03599 | CdhD | CO dehydrogenase/acetyl-CoA synthase delta subunit | 41 | 160 | 0.9 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.