Protein Family IF00798
Metagenome
Isolate
142
Members
64
Samples
125
Scaffolds
405.32
Avg Length
Representative Sequence
- ID
- 3300002462|JGI24702J35022_10024838|JGI24702J35022_100248382
- Length
- 437 aa
- Sequence
- MFYNALHSIDYEGFLGYNNIACLISRRSGFMYITRHLEKTVTELAGMFGAVLVTGPRQVGKTTMLKTVTKDISYITLDDPIMMRAAVEEAGSFFKSIPPPVFVDEIQYAPNLFPYIKMIIDRDNKKGKFYLSGSQQFYMMKNVSESLAGRLGIASMLSLSLREIKGVACRDHFIPTCEYFATRRQTAVPIEYRDIWDIIHRGSMPELYANENMNWQSFYAAYTKTYIERDVRDLTQVGDEVAFLKFMSVIASMTGNLLNLSSVARDIGVSPPTAERWLSVLVASDLVYLLRPYANNMIKRAIKTPKIYFLDTGLAAYLTKWTTPAVLEAGAMAGAFFETFVIAEIIKSYYNAGLDLPLYFYRDRDGNEIDLLIWSDGALHPIEIKKTANPHKGDIRAFGLLEKIPDIKRGQGGVVCMYDKLLALHGEDMIIPVSYL*
Sample Types
Isolate
12.0%
Metagenome
88.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
38.7%
Unclassified
32.3%
Kalotermitidae
17.7%
Rhinotermitidae
4.8%
Termopsidae
4.8%
Hodotermitidae
1.6%
Taxonomy
Archaea
6
Bacteria
127
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820227065 | Unclassified Firmicutes Th196P4bin44 | Isolate | Unclassified |
| 2 | 2820435670 | Unclassified Firmicutes Lab288P3bin217 | Isolate | Unclassified |
| 3 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 4 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 5 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 6 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 7 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 8 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 9 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 10 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 11 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 12 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 13 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 14 | 2820277137 | Unclassified Firmicutes Th196P3bin150 | Isolate | Unclassified |
| 15 | 2820483401 | Unclassified Firmicutes Lab288P1bin74 | Isolate | Unclassified |
| 16 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 17 | 2820234266 | Unclassified Firmicutes Th196P3bin99 | Isolate | Unclassified |
| 18 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 19 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 20 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 21 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 22 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 23 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 24 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 25 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 26 | 2820229114 | Unclassified Firmicutes Th196P4bin40 | Isolate | Unclassified |
| 27 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 28 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 29 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 30 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 31 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 32 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 33 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 34 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 35 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 36 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 37 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 38 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 39 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 40 | 2778260936 | Unclassified Fibrobacteres Co191P3bin13 | Isolate | Unclassified |
| 41 | 2820238527 | Unclassified Firmicutes Th196P3bin90 | Isolate | Unclassified |
| 42 | 2820442516 | Unclassified Firmicutes Lab288P3bin200 | Isolate | Unclassified |
| 43 | 2820490862 | Unclassified Firmicutes Lab288P1bin64 | Isolate | Unclassified |
| 44 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 45 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 46 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 47 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 48 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 49 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 50 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 51 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 52 | 2820312173 | Unclassified Firmicutes Nt197P4bin8 | Isolate | Unclassified |
| 53 | 2820541116 | Unclassified Firmicutes Lab288P1bin109 | Isolate | Unclassified |
| 54 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 55 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 56 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 57 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 58 | 2773857778 | Unclassified Fibrobacteres Co191P1bin56 | Isolate | Unclassified |
| 59 | 2820223845 | Unclassified Firmicutes Th196P4bin57 | Isolate | Unclassified |
| 60 | 2820318056 | Unclassified Firmicutes Nt197P3bin94 | Isolate | Unclassified |
| 61 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 62 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 63 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 64 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_428292 | 3300042656 | Bacteria | 16108 |
| 2 | Ga0466701_086622 | 3300042598 | Unclassified | 4305 |
| 3 | Ga0466707_014389 | 3300042601 | Bacteria | 75654 |
| 4 | Ga0466716_127539 | 3300042605 | Bacteria | 6920 |
| 5 | Ga0466722_089961 | 3300042609 | Bacteria | 18815 |
| 6 | Ga0466723_008160 | 3300042618 | Bacteria | 2622 |
| 7 | Ga0466726_095197 | 3300042619 | Bacteria | 1579 |
| 8 | Ga0466728_050171 | 3300042620 | Bacteria | 3507 |
| 9 | Ga0123353_10044837 | 3300010167 | Bacteria | 7013 |
| 10 | Ga0123353_10078140 | 3300010167 | Bacteria | 5319 |
| 11 | Ga0123354_10243556 | 3300010882 | Bacteria | 1843 |
| 12 | JGI24702J35022_10000083 | 3300002462 | Bacteria | 41864 |
| 13 | JGI24702J35022_10009754 | 3300002462 | Bacteria | 5386 |
| 14 | JGI24702J35022_10019802 | 3300002462 | Bacteria | 3660 |
| 15 | JGI24702J35022_10029297 | 3300002462 | Unclassified | 2955 |
| 16 | Ga0068305_10013580 | 3300005083 | Bacteria | 22922 |
| 17 | Ga0466734_154291 | 3300042623 | Bacteria | 2256 |
| 18 | Ga0264413_103248 | 3300024493 | Bacteria | 8070 |
| 19 | Ga0466694_179521 | 3300042594 | Bacteria | 1837 |
| 20 | Ga0466719_109274 | 3300042606 | Bacteria | 3829 |
| 21 | Ga0123357_10004648 | 3300009784 | Bacteria | 16197 |
| 22 | Ga0123355_10097275 | 3300009826 | Bacteria | 4645 |
| 23 | Ga0123355_10381751 | 3300009826 | Bacteria | 1835 |
| 24 | Ga0123354_10066959 | 3300010882 | Bacteria | 5237 |
| 25 | JGI24702J35022_10034192 | 3300002462 | Bacteria | 2719 |
| 26 | Ga0466729_197854 | 3300042621 | Bacteria | 1758 |
| 27 | Ga0466704_249394 | 3300042643 | Bacteria | 4822 |
| 28 | Ga0466725_258902 | 3300042654 | Bacteria | 2922 |
| 29 | Ga0415639_011076 | 3300038395 | Bacteria | 32364 |
| 30 | Ga0466690_429207 | 3300042590 | Unclassified | 2555 |
| 31 | Ga0466699_210614 | 3300042597 | Bacteria | 2811 |
| 32 | Ga0466700_455840 | 3300042600 | Bacteria | 15479 |
| 33 | Ga0466719_532091 | 3300042606 | Bacteria | 28391 |
| 34 | Ga0466718_109731 | 3300042617 | Bacteria | 1805 |
| 35 | Ga0123357_10312166 | 3300009784 | Bacteria | 1568 |
| 36 | Ga0123355_10076909 | 3300009826 | Bacteria | 5336 |
| 37 | Ga0123353_10407552 | 3300010167 | Bacteria | 2020 |
| 38 | Ga0123354_10147334 | 3300010882 | Bacteria | 2874 |
| 39 | Ga0466735_060851 | 3300042624 | Bacteria | 1657 |
| 40 | Ga0466704_347416 | 3300042643 | Bacteria | 1847 |
| 41 | Ga0466692_025481 | 3300042591 | Archaea | 2129 |
| 42 | Ga0466692_028599 | 3300042591 | Bacteria | 21393 |
| 43 | Ga0466697_259147 | 3300042611 | Bacteria | 3832 |
| 44 | Ga0466713_023623 | 3300042602 | Bacteria | 10328 |
| 45 | Ga0466705_387807 | 3300042612 | Bacteria | 12608 |
| 46 | Ga0466726_334614 | 3300042619 | Bacteria | 2345 |
| 47 | Ga0123357_10226394 | 3300009784 | Archaea | 2061 |
| 48 | Ga0123355_10017462 | 3300009826 | Bacteria | 11341 |
| 49 | Ga0123355_10158214 | 3300009826 | Bacteria | 3421 |
| 50 | Ga0123356_10015334 | 3300010049 | Bacteria | 7348 |
| 51 | Ga0123356_10082548 | 3300010049 | Bacteria | 3043 |
| 52 | Ga0123353_10638069 | 3300010167 | Bacteria | 1511 |
| 53 | JGI24698J34947_10003356 | 3300002449 | Bacteria | 8692 |
| 54 | JGI24695J34938_10000685 | 3300002450 | Unclassified | 31998 |
| 55 | JGI24702J35022_10000080 | 3300002462 | Bacteria | 42310 |
| 56 | JGI24703J35330_11725914 | 3300002501 | Bacteria | 2534 |
| 57 | JGI24705J35276_12238445 | 3300002504 | Bacteria | 22433 |
| 58 | Ga0466704_220215 | 3300042643 | Bacteria | 4851 |
| 59 | Ga0466704_430317 | 3300042643 | Bacteria | 2871 |
| 60 | Ga0264413_107387 | 3300024493 | Bacteria | 5054 |
| 61 | Ga0466693_063470 | 3300042592 | Bacteria | 1919 |
| 62 | Ga0466693_243365 | 3300042592 | Bacteria | 1971 |
| 63 | Ga0466697_271529 | 3300042611 | Archaea | 13329 |
| 64 | Ga0466705_021502 | 3300042612 | Bacteria | 7759 |
| 65 | Ga0466705_050851 | 3300042612 | Bacteria | 1893 |
| 66 | Ga0466733_162899 | 3300042659 | Bacteria | 1676 |
| 67 | Ga0466706_040298 | 3300042599 | Bacteria | 82406 |
| 68 | Ga0466722_096192 | 3300042609 | Bacteria | 2011 |
| 69 | Ga0466712_297230 | 3300042614 | Bacteria | 45707 |
| 70 | Ga0466711_028629 | 3300042615 | Bacteria | 11505 |
| 71 | Ga0466723_343129 | 3300042618 | Bacteria | 2267 |
| 72 | Ga0123355_10000093 | 3300009826 | Bacteria | 94422 |
| 73 | Ga0123355_10337892 | 3300009826 | Bacteria | 2010 |
| 74 | Ga0123356_10059107 | 3300010049 | Bacteria | 3576 |
| 75 | Ga0123353_10000129 | 3300010167 | Bacteria | 91485 |
| 76 | Ga0123353_10452385 | 3300010167 | Bacteria | 1890 |
| 77 | Ga0123354_10008684 | 3300010882 | Archaea | 15489 |
| 78 | JGI24698J34947_10010225 | 3300002449 | Bacteria | 5145 |
| 79 | JGI24702J35022_10044920 | 3300002462 | Bacteria | 2354 |
| 80 | Ga0466703_299525 | 3300042636 | Bacteria | 7237 |
| 81 | Ga0466727_147229 | 3300042655 | Unclassified | 2673 |
| 82 | Ga0264413_125382 | 3300024493 | Bacteria | 1520 |
| 83 | Ga0466693_309550 | 3300042592 | Bacteria | 1603 |
| 84 | Ga0466694_024654 | 3300042594 | Bacteria | 3041 |
| 85 | Ga0466701_090641 | 3300042598 | Archaea | 8299 |
| 86 | Ga0466700_406751 | 3300042600 | Bacteria | 1344 |
| 87 | Ga0466718_076458 | 3300042617 | Bacteria | 6790 |
| 88 | Ga0466726_447221 | 3300042619 | Bacteria | 3555 |
| 89 | Ga0123357_10111846 | 3300009784 | Bacteria | 3478 |
| 90 | Ga0123355_10325720 | 3300009826 | Bacteria | 2064 |
| 91 | Ga0123356_10024862 | 3300010049 | Bacteria | 5632 |
| 92 | Ga0123353_10190855 | 3300010167 | Bacteria | 3234 |
| 93 | Ga0123353_10423655 | 3300010167 | Bacteria | 1971 |
| 94 | JGI24702J35022_10024838 | 3300002462 | Bacteria | 3235 |
| 95 | JGI24702J35022_10035972 | 3300002462 | Bacteria | 2647 |
| 96 | Ga0072941_1003572 | 3300005201 | Bacteria | 38999 |
| 97 | Ga0466735_214623 | 3300042624 | Bacteria | 4211 |
| 98 | Ga0466703_366904 | 3300042636 | Bacteria | 1964 |
| 99 | Ga0466692_159465 | 3300042591 | Bacteria | 1903 |
| 100 | Ga0466693_027841 | 3300042592 | Bacteria | 1813 |
| 101 | Ga0466691_052522 | 3300042593 | Bacteria | 6028 |
| 102 | Ga0466732_288869 | 3300042656 | Bacteria | 2046 |
| 103 | Ga0466700_314012 | 3300042600 | Bacteria | 1981 |
| 104 | Ga0466707_178334 | 3300042601 | Unclassified | 3749 |
| 105 | Ga0466715_087363 | 3300042616 | Bacteria | 7568 |
| 106 | Ga0466718_004612 | 3300042617 | Bacteria | 3919 |
| 107 | Ga0466718_077318 | 3300042617 | Bacteria | 1578 |
| 108 | Ga0123355_10165027 | 3300009826 | Bacteria | 3326 |
| 109 | Ga0123356_10351069 | 3300010049 | Bacteria | 1599 |
| 110 | JGI24698J34947_10004701 | 3300002449 | Bacteria | 7454 |
| 111 | JGI24696J40584_12960307 | 3300002834 | Archaea | 6875 |
| 112 | Ga0466694_140896 | 3300042594 | Bacteria | 3342 |
| 113 | Ga0466726_217880 | 3300042619 | Bacteria | 4738 |
| 114 | Ga0123357_10054558 | 3300009784 | Bacteria | 5387 |
| 115 | Ga0123355_10453844 | 3300009826 | Bacteria | 1613 |
| 116 | Ga0123356_10241191 | 3300010049 | Unclassified | 1879 |
| 117 | Ga0123356_10278491 | 3300010049 | Bacteria | 1766 |
| 118 | Ga0123353_10303789 | 3300010167 | Unclassified | 2434 |
| 119 | Ga0123353_10310195 | 3300010167 | Bacteria | 2402 |
| 120 | JGI24702J35022_10063720 | 3300002462 | Bacteria | 1975 |
| 121 | Ga0068305_10150479 | 3300005083 | Unclassified | 4962 |
| 122 | Ga0415639_002733 | 3300038395 | Bacteria | 94318 |
| 123 | Ga0466691_021299 | 3300042593 | Bacteria | 3985 |
| 124 | Ga0466694_073464 | 3300042594 | Bacteria | 7600 |
| 125 | Ga0466699_137528 | 3300042597 | Bacteria | 24938 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.