Protein Family IF00781
Metagenome
Metatranscriptome
Isolate
156
Members
70
Samples
136
Scaffolds
207.8
Avg Length
Representative Sequence
- ID
- 3300002462|JGI24702J35022_10010267|JGI24702J35022_100102671
- Length
- 233 aa
- Sequence
- MDAVRRNAEEFDGAVEMARYTGPVCKLCRREMQPLMLKGQRCMTEKCPLKEGASNTKTKKYPPGPPRKRRTKMSDYAVQLREKQKIKRSYCLLEKQFRRTFDEANRMKGVTGDNMLSLLERRLENVIYRMGFATSRNQARQLVFHKHVMVNGKTVDIPSFLVKENMEVMIAENFRQNPFLEGSIMLTKASESVPEWLEVDFDNKSGKIIRLPIRSDVVADFNEQLVVELYSK*
Sample Types
Isolate
12.8%
Metagenome
85.9%
MAG
0.0%
Metatranscriptome
1.3%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
41.8%
Unclassified
32.8%
Kalotermitidae
19.4%
Termopsidae
3.0%
Rhinotermitidae
1.5%
Hodotermitidae
1.5%
Taxonomy
Archaea
0
Bacteria
143
Eukaryota
0
Viruses
0
Unclassified
13
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820510699 | Unclassified Firmicutes Lab288P1bin40 | Isolate | Unclassified |
| 2 | 2820526825 | Unclassified Firmicutes Lab288P1bin16 | Isolate | Unclassified |
| 3 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 4 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 5 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 6 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 7 | 2820010479 | Unclassified Spirochaetes Th196P4bin55 | Isolate | Unclassified |
| 8 | 2820669764 | Unclassified Firmicutes Co191P3bin30 | Isolate | Unclassified |
| 9 | 2820680340 | Unclassified Firmicutes Co191P1bin89 | Isolate | Unclassified |
| 10 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 11 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 12 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 13 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 14 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 15 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 16 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 17 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 18 | 2820014844 | Unclassified Spirochaetes Nt197P3bin95 | Isolate | Unclassified |
| 19 | 2820506701 | Unclassified Firmicutes Lab288P1bin46 | Isolate | Unclassified |
| 20 | 2820530071 | Unclassified Firmicutes Lab288P1bin142 | Isolate | Unclassified |
| 21 | 2820545146 | Unclassified Firmicutes Lab288P1bin104 | Isolate | Unclassified |
| 22 | 2820558799 | Unclassified Firmicutes Emb289P3bin74 | Isolate | Unclassified |
| 23 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 24 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 25 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 26 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 27 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 28 | 2820497731 | Unclassified Firmicutes Lab288P1bin55 | Isolate | Unclassified |
| 29 | 2820556368 | Unclassified Firmicutes Emb289P3bin92 | Isolate | Unclassified |
| 30 | 2820572885 | Unclassified Firmicutes Emb289P3bin161 | Isolate | Unclassified |
| 31 | 2820947865 | Unclassified Acidobacteria Nt197P3bin133 | Isolate | Unclassified |
| 32 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 33 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 34 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 35 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 36 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 37 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 38 | 2820263778 | Unclassified Firmicutes Th196P3bin37 | Isolate | Unclassified |
| 39 | 2820462123 | Unclassified Firmicutes Lab288P3bin129 | Isolate | Unclassified |
| 40 | 2820611732 | Unclassified Firmicutes Emb289P1bin19 | Isolate | Unclassified |
| 41 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 42 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 43 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 44 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 45 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 46 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 47 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 48 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 49 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 50 | 2820400448 | Unclassified Firmicutes Nc150Mbin1 | Isolate | Unclassified |
| 51 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 52 | 2819998259 | Unclassified Spirochaetes Nc150P4bin23 | Isolate | Unclassified |
| 53 | 2820396902 | Unclassified Firmicutes Nc150P1bin3 | Isolate | Unclassified |
| 54 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 55 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 56 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 57 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 58 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 59 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 60 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 61 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 62 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 63 | 3300021190 | Termite gut microbial communities from nest - French Guiana - 1_3 mRNA 1_3 mRNA SA | Metatranscriptome | Termitidae |
| 64 | 3300021237 | Termite gut microbial communities from nest from French Guiana -FG16_15_2 mRNA SA | Metatranscriptome | |
| 65 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 66 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 67 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 68 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 69 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 70 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_240040 | 3300042656 | Bacteria | 2708 |
| 2 | Ga0123355_10021961 | 3300009826 | Unclassified | 10227 |
| 3 | Ga0123356_10000862 | 3300010049 | Bacteria | 33705 |
| 4 | Ga0123356_10045197 | 3300010049 | Bacteria | 4098 |
| 5 | Ga0123353_10062368 | 3300010167 | Bacteria | 5979 |
| 6 | Ga0466696_023405 | 3300042596 | Bacteria | 42390 |
| 7 | Ga0466696_137941 | 3300042596 | Bacteria | 25447 |
| 8 | JGI24700J35501_10889652 | 3300002508 | Bacteria | 2653 |
| 9 | JGI24696J40584_12894572 | 3300002834 | Bacteria | 1149 |
| 10 | Ga0072941_1330392 | 3300005201 | Bacteria | 2555 |
| 11 | Ga0466709_345400 | 3300042648 | Bacteria | 6688 |
| 12 | Ga0466713_018581 | 3300042602 | Bacteria | 91213 |
| 13 | Ga0466714_162069 | 3300042603 | Bacteria | 1466 |
| 14 | Ga0466717_182496 | 3300042604 | Bacteria | 1830 |
| 15 | Ga0466716_238068 | 3300042605 | Bacteria | 3613 |
| 16 | Ga0466715_038082 | 3300042616 | Bacteria | 19718 |
| 17 | Ga0466715_040556 | 3300042616 | Bacteria | 48791 |
| 18 | Ga0466705_160225 | 3300042612 | Bacteria | 45310 |
| 19 | Ga0123357_10303845 | 3300009784 | Bacteria | 1606 |
| 20 | Ga0123357_10517058 | 3300009784 | Bacteria | 978 |
| 21 | Ga0123355_10697779 | 3300009826 | Bacteria | 1167 |
| 22 | Ga0123353_10075720 | 3300010167 | Bacteria | 5407 |
| 23 | Ga0123354_10035483 | 3300010882 | Bacteria | 7785 |
| 24 | Ga0466699_202468 | 3300042597 | Bacteria | 7425 |
| 25 | Ga0072941_1250356 | 3300005201 | Unclassified | 2633 |
| 26 | Ga0466709_344133 | 3300042648 | Bacteria | 3538 |
| 27 | Ga0466708_410713 | 3300042652 | Bacteria | 5655 |
| 28 | Ga0466706_091777 | 3300042599 | Bacteria | 59128 |
| 29 | Ga0466717_203571 | 3300042604 | Bacteria | 2095 |
| 30 | Ga0466711_202977 | 3300042615 | Bacteria | 8125 |
| 31 | Ga0466711_328250 | 3300042615 | Bacteria | 50562 |
| 32 | Ga0466715_154133 | 3300042616 | Bacteria | 37484 |
| 33 | Ga0123355_10005105 | 3300009826 | Bacteria | 19144 |
| 34 | Ga0123355_10164349 | 3300009826 | Bacteria | 3335 |
| 35 | Ga0123355_10246231 | 3300009826 | Bacteria | 2524 |
| 36 | Ga0123353_10569930 | 3300010167 | Unclassified | 1628 |
| 37 | Ga0264413_156405 | 3300024493 | Bacteria | 2641 |
| 38 | Ga0466690_054853 | 3300042590 | Bacteria | 4045 |
| 39 | Ga0466695_377735 | 3300042595 | Bacteria | 1703 |
| 40 | Ga0466696_252127 | 3300042596 | Bacteria | 17039 |
| 41 | Ga0466699_381188 | 3300042597 | Bacteria | 1763 |
| 42 | Ga0466706_111604 | 3300042599 | Bacteria | 1126 |
| 43 | Ga0466719_546615 | 3300042606 | Bacteria | 1806 |
| 44 | Ga0466720_020310 | 3300042607 | Bacteria | 2437 |
| 45 | Ga0466715_120862 | 3300042616 | Bacteria | 8032 |
| 46 | Ga0466715_487463 | 3300042616 | Bacteria | 4243 |
| 47 | Ga0466718_161218 | 3300042617 | Bacteria | 19936 |
| 48 | Ga0466723_038419 | 3300042618 | Bacteria | 31685 |
| 49 | Ga0466723_094930 | 3300042618 | Bacteria | 2380 |
| 50 | Ga0466723_336515 | 3300042618 | Bacteria | 5641 |
| 51 | Ga0466728_342992 | 3300042620 | Bacteria | 1872 |
| 52 | Ga0466728_347766 | 3300042620 | Bacteria | 6561 |
| 53 | Ga0466705_285307 | 3300042612 | Bacteria | 25130 |
| 54 | Ga0466705_325997 | 3300042612 | Bacteria | 31796 |
| 55 | Ga0466732_067770 | 3300042656 | Unclassified | 5179 |
| 56 | Ga0123355_10019163 | 3300009826 | Bacteria | 10887 |
| 57 | Ga0123356_10076076 | 3300010049 | Bacteria | 3163 |
| 58 | Ga0123353_10021043 | 3300010167 | Bacteria | 9773 |
| 59 | Ga0466694_204704 | 3300042594 | Unclassified | 1985 |
| 60 | Ga0466695_222321 | 3300042595 | Bacteria | 9388 |
| 61 | Ga0466703_340956 | 3300042636 | Bacteria | 1930 |
| 62 | Ga0466708_201489 | 3300042652 | Bacteria | 43335 |
| 63 | Ga0466707_163801 | 3300042601 | Bacteria | 828024 |
| 64 | Ga0466717_204856 | 3300042604 | Unclassified | 2264 |
| 65 | Ga0466716_475582 | 3300042605 | Bacteria | 3106 |
| 66 | Ga0466719_077181 | 3300042606 | Bacteria | 4295 |
| 67 | Ga0466710_168260 | 3300042613 | Bacteria | 1768 |
| 68 | Ga0466711_269482 | 3300042615 | Bacteria | 3211 |
| 69 | Ga0466715_128043 | 3300042616 | Bacteria | 6375 |
| 70 | Ga0466723_019869 | 3300042618 | Bacteria | 35706 |
| 71 | Ga0123355_10000012 | 3300009826 | Bacteria | 181780 |
| 72 | Ga0123355_10004905 | 3300009826 | Bacteria | 19468 |
| 73 | Ga0123355_10748547 | 3300009826 | Bacteria | 1106 |
| 74 | Ga0123353_10023712 | 3300010167 | Bacteria | 9297 |
| 75 | Ga0415639_025040 | 3300038395 | Bacteria | 32469 |
| 76 | Ga0466690_281913 | 3300042590 | Bacteria | 36067 |
| 77 | Ga0466694_183723 | 3300042594 | Bacteria | 21712 |
| 78 | JGI24702J35022_10030285 | 3300002462 | Unclassified | 2903 |
| 79 | Ga0072940_1007047 | 3300005200 | Unclassified | 8578 |
| 80 | Ga0466703_311388 | 3300042636 | Bacteria | 3401 |
| 81 | Ga0466709_409548 | 3300042648 | Unclassified | 2019 |
| 82 | Ga0466708_054591 | 3300042652 | Bacteria | 89967 |
| 83 | Ga0466727_034911 | 3300042655 | Bacteria | 1466 |
| 84 | Ga0466700_253842 | 3300042600 | Bacteria | 1359 |
| 85 | Ga0466719_228707 | 3300042606 | Bacteria | 5858 |
| 86 | Ga0466715_069772 | 3300042616 | Bacteria | 32177 |
| 87 | Ga0466718_030844 | 3300042617 | Bacteria | 2871 |
| 88 | Ga0466723_192342 | 3300042618 | Bacteria | 20312 |
| 89 | Ga0466723_232062 | 3300042618 | Bacteria | 62764 |
| 90 | Ga0123355_10001225 | 3300009826 | Bacteria | 35784 |
| 91 | Ga0123355_10639156 | 3300009826 | Bacteria | 1247 |
| 92 | Ga0123355_10996630 | 3300009826 | Bacteria | 891 |
| 93 | Ga0123356_10057646 | 3300010049 | Bacteria | 3621 |
| 94 | Ga0223675_1000935 | 3300021237 | Bacteria | 2692 |
| 95 | Ga0264413_164033 | 3300024493 | Bacteria | 1371 |
| 96 | Ga0415639_100564 | 3300038395 | Bacteria | 1912 |
| 97 | Ga0466691_209260 | 3300042593 | Bacteria | 5285 |
| 98 | Ga0466699_391419 | 3300042597 | Unclassified | 3215 |
| 99 | JGI24698J34947_10001360 | 3300002449 | Bacteria | 12855 |
| 100 | JGI24695J34938_10019061 | 3300002450 | Bacteria | 3411 |
| 101 | Ga0072941_1008137 | 3300005201 | Bacteria | 12136 |
| 102 | Ga0072941_1688570 | 3300005201 | Bacteria | 1016 |
| 103 | Ga0466734_050334 | 3300042623 | Bacteria | 2419 |
| 104 | Ga0466703_382073 | 3300042636 | Bacteria | 3532 |
| 105 | Ga0466709_130369 | 3300042648 | Bacteria | 9653 |
| 106 | Ga0466720_141828 | 3300042607 | Unclassified | 1640 |
| 107 | Ga0466712_068494 | 3300042614 | Bacteria | 1865 |
| 108 | Ga0466718_111055 | 3300042617 | Bacteria | 1264 |
| 109 | Ga0466718_116523 | 3300042617 | Unclassified | 2114 |
| 110 | Ga0123353_10006767 | 3300010167 | Unclassified | 15359 |
| 111 | Ga0466690_208626 | 3300042590 | Bacteria | 1807 |
| 112 | Ga0466690_247599 | 3300042590 | Bacteria | 1493 |
| 113 | Ga0466693_138326 | 3300042592 | Bacteria | 1685 |
| 114 | Ga0466691_191273 | 3300042593 | Bacteria | 20272 |
| 115 | Ga0466694_021830 | 3300042594 | Bacteria | 15157 |
| 116 | Ga0466699_064292 | 3300042597 | Bacteria | 4860 |
| 117 | JGI24698J34947_10007438 | 3300002449 | Bacteria | 6020 |
| 118 | JGI24695J34938_10000226 | 3300002450 | Bacteria | 53266 |
| 119 | Ga0466703_296238 | 3300042636 | Bacteria | 15890 |
| 120 | Ga0466714_062235 | 3300042603 | Bacteria | 4909 |
| 121 | Ga0466705_526881 | 3300042612 | Bacteria | 4522 |
| 122 | Ga0466712_137270 | 3300042614 | Bacteria | 3665 |
| 123 | Ga0466723_344622 | 3300042618 | Bacteria | 35563 |
| 124 | Ga0466705_354103 | 3300042612 | Bacteria | 9789 |
| 125 | Ga0123353_10712800 | 3300010167 | Bacteria | 1405 |
| 126 | Ga0222431_1010041 | 3300021190 | Bacteria | 3557 |
| 127 | JGI24702J35022_10010267 | 3300002462 | Bacteria | 5237 |
| 128 | Ga0466731_065936 | 3300042622 | Bacteria | 20008 |
| 129 | Ga0466702_157150 | 3300042635 | Bacteria | 1813 |
| 130 | Ga0466727_012226 | 3300042655 | Bacteria | 1486 |
| 131 | Ga0466714_080112 | 3300042603 | Bacteria | 6977 |
| 132 | Ga0466715_085223 | 3300042616 | Bacteria | 5212 |
| 133 | Ga0466715_131933 | 3300042616 | Bacteria | 43814 |
| 134 | Ga0466718_085948 | 3300042617 | Bacteria | 9068 |
| 135 | Ga0466726_031948 | 3300042619 | Bacteria | 19088 |
| 136 | Ga0466729_003595 | 3300042621 | Bacteria | 5199 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01479 | GO:0003723 | RNA binding | MF |
| PF00163 | GO:0019843 | rRNA binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.