Protein Family IF00772

Metagenome Metatranscriptome Isolate
140 Members
53 Samples
113 Scaffolds
147.39 Avg Length

🧬 Representative Sequence

ID
3300002462|JGI24702J35022_10007354|JGI24702J35022_100073544
Length
163 aa
Sequence
MVPYNYPRQKRWQVKMKVVLQRVSRASVSVGGEIVGSIGAGFVALLGIGGDNEAGMEKIEKMVDKIQKLRIFPDSKGKTNRSIGDVGGGILVISQFTLYADCKKGNRPSFADAAPPELAKKLYEYFIEYAKDKFETVAHGIFGASMSVELTNEGPFTVILEG*

📊 Sample Types

Isolate 19.3%
Metagenome 80.0%
MAG 0.0%
Metatranscriptome 0.7%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 50.9%
Termitidae 39.6%
Blattidae 5.7%
Passalidae 3.8%

🌳 Taxonomy

Archaea 0
Bacteria 134
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940343849 Breznakia sp. PH5-24 Isolate Blattidae
2 2820242869 Unclassified Firmicutes Th196P3bin82 Isolate Unclassified
3 2820623020 Unclassified Firmicutes Emb289P1bin126 Isolate Unclassified
4 2820696217 Unclassified Firmicutes Co191P1bin66 Isolate Unclassified
5 2820229114 Unclassified Firmicutes Th196P4bin40 Isolate Unclassified
6 2820249082 Unclassified Firmicutes Th196P3bin69 Isolate Unclassified
7 2820280018 Unclassified Firmicutes Th196P3bin149 Isolate Unclassified
8 2820676843 Unclassified Firmicutes Co191P3bin17 Isolate Unclassified
9 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
10 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
11 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
12 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
13 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
14 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
15 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
16 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
17 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
18 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
19 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
20 2940236825 Breznakia sp. PM6-1 Isolate Blattidae
21 2820602899 Unclassified Firmicutes Emb289P1bin51 Isolate Unclassified
22 2820698910 Unclassified Firmicutes Co191P1bin64 Isolate Unclassified
23 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
24 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
25 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
26 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
27 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
28 2820360414 Unclassified Firmicutes Nt197P3bin121 Isolate Unclassified
29 2820427814 Unclassified Firmicutes Lab288P3bin44 Isolate Unclassified
30 2820615445 Unclassified Firmicutes Emb289P1bin132 Isolate Unclassified
31 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
32 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
33 3300021192 Termite gut microbial communities from nest - French Guiana - 5_4 mRNA SA Metatranscriptome Termitidae
34 2820252425 Unclassified Firmicutes Th196P3bin6 Isolate Unclassified
35 2820303403 Unclassified Firmicutes Th196P1bin2 Isolate Unclassified
36 2820522177 Unclassified Firmicutes Lab288P1bin22 Isolate Unclassified
37 2820590132 Unclassified Firmicutes Emb289P1bin84 Isolate Unclassified
38 2820702360 Unclassified Firmicutes Co191P1bin4 Isolate Unclassified
39 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
40 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
41 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
42 2820296961 Unclassified Firmicutes Th196P3bin102 Isolate Unclassified
43 2820432912 Unclassified Firmicutes Lab288P3bin219 Isolate Unclassified
44 2820530790 Unclassified Firmicutes Lab288P1bin141 Isolate Unclassified
45 2820600392 Unclassified Firmicutes Emb289P1bin52 Isolate Unclassified
46 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
47 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
48 2940339133 Breznakia sp. PF5-3 Isolate Blattidae
49 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
50 2820362221 Unclassified Firmicutes Nt197P3bin116 Isolate Unclassified
51 2820576413 Unclassified Firmicutes Emb289P3bin136 Isolate Unclassified
52 2820617402 Unclassified Firmicutes Emb289P1bin131 Isolate Unclassified
53 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123355_10062077 3300009826 Bacteria 6032
2 Ga0123355_10096111 3300009826 Unclassified 4680
3 Ga0123355_10240363 3300009826 Bacteria 2567
4 Ga0123355_10513590 3300009826 Bacteria 1470
5 Ga0123355_10630459 3300009826 Bacteria 1259
6 Ga0123356_13173364 3300010049 Bacteria 572
7 Ga0123353_10269760 3300010167 Bacteria 2623
8 Ga0123353_11743071 3300010167 Bacteria 777
9 Ga0123353_12416822 3300010167 Unclassified 628
10 Ga0466707_283162 3300042601 Bacteria 12590
11 Ga0466714_028175 3300042603 Bacteria 1068
12 Ga0466714_084647 3300042603 Bacteria 2249
13 JGI24702J35022_10007354 3300002462 Bacteria 6320
14 Ga0123355_10000892 3300009826 Bacteria 41336
15 Ga0123355_10806905 3300009826 Bacteria 1045
16 Ga0123355_10976734 3300009826 Bacteria 904
17 Ga0123355_11031871 3300009826 Bacteria 868
18 Ga0123356_10823724 3300010049 Bacteria 1099
19 Ga0123356_11575936 3300010049 Bacteria 812
20 Ga0123353_10000072 3300010167 Bacteria 110004
21 Ga0123353_10233811 3300010167 Bacteria 2863
22 Ga0123353_10519971 3300010167 Bacteria 1727
23 Ga0123353_11818181 3300010167 Bacteria 756
24 Ga0466700_376802 3300042600 Bacteria 3196
25 Ga0466714_118899 3300042603 Bacteria 1418
26 Ga0415639_030073 3300038395 Bacteria 2593
27 Ga0415639_054169 3300038395 Bacteria 1932
28 Ga0466701_005760 3300042598 Bacteria 7106
29 Ga0123355_10000792 3300009826 Bacteria 43253
30 Ga0123355_10024571 3300009826 Bacteria 9689
31 Ga0123356_12877886 3300010049 Bacteria 602
32 Ga0123353_10530369 3300010167 Bacteria 1705
33 Ga0123353_10804497 3300010167 Bacteria 1297
34 Ga0123353_12064990 3300010167 Bacteria 695
35 Ga0123353_12176955 3300010167 Bacteria 672
36 Ga0123353_12763367 3300010167 Bacteria 576
37 Ga0123354_10210134 3300010882 Unclassified 2106
38 Ga0466700_360785 3300042600 Bacteria 1186
39 Ga0466713_102526 3300042602 Bacteria 2699
40 Ga0466714_000907 3300042603 Bacteria 1172
41 Ga0415639_006027 3300038395 Bacteria 4042
42 Ga0415639_017940 3300038395 Bacteria 9495
43 Ga0415639_061799 3300038395 Bacteria 1216
44 JGI24703J35330_11748767 3300002501 Bacteria 33003
45 Ga0123355_10000765 3300009826 Bacteria 43929
46 Ga0123355_10003712 3300009826 Bacteria 22025
47 Ga0123355_10009767 3300009826 Bacteria 14631
48 Ga0123355_10077256 3300009826 Bacteria 5323
49 Ga0123356_10013549 3300010049 Bacteria 7863
50 Ga0123356_10251731 3300010049 Bacteria 1844
51 Ga0123353_10274255 3300010167 Bacteria 2596
52 Ga0123353_13134973 3300010167 Bacteria 532
53 Ga0466713_126144 3300042602 Bacteria 6315
54 Ga0415639_038310 3300038395 Bacteria 2185
55 2227644058 2225789004 Bacteria 10957
56 Ga0123355_10254141 3300009826 Bacteria 2469
57 Ga0123355_10699700 3300009826 Bacteria 1164
58 Ga0123356_10398912 3300010049 Bacteria 1513
59 Ga0123356_12684168 3300010049 Bacteria 624
60 Ga0123353_11269237 3300010167 Bacteria 959
61 Ga0123353_11602697 3300010167 Bacteria 822
62 Ga0466717_052526 3300042604 Bacteria 1227
63 Ga0415639_057874 3300038395 Unclassified 1183
64 Ga0415639_071955 3300038395 Bacteria 1493
65 Ga0068305_10002253 3300005083 Unclassified 63545
66 Ga0123355_10023962 3300009826 Bacteria 9802
67 Ga0123355_10244747 3300009826 Bacteria 2534
68 Ga0123355_10662095 3300009826 Bacteria 1214
69 Ga0123355_10780442 3300009826 Bacteria 1072
70 Ga0123353_10334129 3300010167 Bacteria 2292
71 Ga0123353_10694610 3300010167 Bacteria 1430
72 Ga0466714_027570 3300042603 Bacteria 3850
73 Ga0466714_146974 3300042603 Bacteria 13071
74 Ga0466721_400552 3300042608 Bacteria 1072
75 Ga0466710_354603 3300042613 Bacteria 1636
76 Ga0222432_1004343 3300021192 Bacteria 1973
77 Ga0415639_065676 3300038395 Bacteria 1111
78 Ga0415639_093514 3300038395 Bacteria 3203
79 Ga0415639_155869 3300038395 Bacteria 3038
80 AustNasuHG_c1007735 3300000089 Bacteria 3814
81 JGI24696J40584_12760001 3300002834 Bacteria 806
82 Ga0123355_10642496 3300009826 Bacteria 1242
83 Ga0123355_10967159 3300009826 Bacteria 911
84 Ga0123355_11507145 3300009826 Bacteria 655
85 Ga0123356_10380517 3300010049 Bacteria 1544
86 Ga0123353_10938738 3300010167 Bacteria 1172
87 Ga0123353_11041629 3300010167 Bacteria 1094
88 Ga0123353_11379523 3300010167 Bacteria 908
89 Ga0123354_11023409 3300010882 Bacteria 530
90 Ga0466700_385005 3300042600 Unclassified 2725
91 Ga0466714_008290 3300042603 Bacteria 2968
92 Ga0415639_174290 3300038395 Bacteria 4520
93 IMNBL1DRAFT_c0000028 3300000062 Bacteria 135353
94 JGI24705J35276_12036882 3300002504 Bacteria 897
95 Ga0123357_10376875 3300009784 Bacteria 1322
96 Ga0123355_10101841 3300009826 Bacteria 4518
97 Ga0123355_10375221 3300009826 Bacteria 1859
98 Ga0123355_10688618 3300009826 Bacteria 1178
99 Ga0123355_11179502 3300009826 Bacteria 785
100 Ga0123355_11531244 3300009826 Bacteria 648
101 Ga0123353_10072917 3300010167 Bacteria 5518
102 Ga0123353_10406273 3300010167 Bacteria 2024
103 Ga0123353_10605729 3300010167 Bacteria 1564
104 Ga0123353_10703018 3300010167 Bacteria 1418
105 Ga0123353_12018783 3300010167 Bacteria 706
106 Ga0123353_12117546 3300010167 Bacteria 684
107 Ga0123354_10726559 3300010882 Bacteria 687
108 Ga0466721_176725 3300042608 Bacteria 2693
109 Ga0415639_093501 3300038395 Bacteria 2318
110 Ga0466694_195519 3300042594 Bacteria 1119
111 Ga0466730_074147 3300042625 Bacteria 2737
112 JGI24695J34938_10000024 3300002450 Bacteria 109661
113 JGI24695J34938_10000382 3300002450 Bacteria 43916

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02580 Tyr_Deacylase D-Tyr-tRNA(Tyr) deacylase 17 161 0.95

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.